DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15873 and MP1

DIOPT Version :9

Sequence 1:NP_611910.2 Gene:CG15873 / 37898 FlyBaseID:FBgn0035003 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_001303421.1 Gene:MP1 / 40541 FlyBaseID:FBgn0027930 Length:400 Species:Drosophila melanogaster


Alignment Length:191 Identity:58/191 - (30%)
Similarity:84/191 - (43%) Gaps:28/191 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 HFCSGVLVSSRAVLTAAHCLT-------------DRYKASMNPRGIRVVFGHITRLAVYDESDFR 118
            |.|.|.|::.|.|||||||::             ..:.||.||   ....|...|....:.....
  Fly   166 HHCGGSLINHRYVLTAAHCVSAIPSDWELTGVRLGEWDASTNP---DCTVGKNGRRDCNEPYVDY 227

  Fly   119 SVDRLVVHPEY---ERYKKNDLAILRLSERVQSSNHDV---LPLLMRKTANVTYGDTCITLGWGQ 177
            .|:..:.||:|   .|.:.||:|:|||.:.||.|:..:   ||.|..:..|:..|...:..|||:
  Fly   228 PVEERIPHPQYPGNSRDQLNDIALLRLRDEVQYSDFILPVCLPTLASQHNNIFLGRKVVVAGWGR 292

  Fly   178 IYQHGPYSNEL-VYLDVILRPPSLCQKHYDT---FTADHNVCTEPVGESMNCAGDMGGPLL 234
            ...:...:.:| ..||.:  |.|.|.:.|.|   ......:|...|....:|.||.|||||
  Fly   293 TETNFTSNIKLKAELDTV--PTSECNQRYATQRRTVTTKQMCAGGVEGVDSCRGDSGGPLL 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15873NP_611910.2 Tryp_SPc 36..250 CDD:214473 58/191 (30%)
Tryp_SPc 59..250 CDD:238113 58/191 (30%)
MP1NP_001303421.1 CLIP 29..91 CDD:288855
Tryp_SPc 137..394 CDD:214473 58/191 (30%)
Tryp_SPc 138..397 CDD:238113 58/191 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436721
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.