DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15873 and CG18223

DIOPT Version :9

Sequence 1:NP_611910.2 Gene:CG15873 / 37898 FlyBaseID:FBgn0035003 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_649077.1 Gene:CG18223 / 40068 FlyBaseID:FBgn0036832 Length:322 Species:Drosophila melanogaster


Alignment Length:278 Identity:82/278 - (29%)
Similarity:144/278 - (51%) Gaps:20/278 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 QILTVFLGLILSTSLSDADLGVIGDISDETF----EMLISGGY--KPKSNRLSRHVVSIRTKNYV 60
            :|.:..|.|:|...:.||     ||.....|    ...:|..|  |.|:..|:::|||||::...
  Fly    11 KIFSFLLFLLLLLPILDA-----GDPIGSHFVRRRAKRLSSPYFDKEKTLVLAKYVVSIRSRRPH 70

  Fly    61 RHRGDNHFCSGVLVSSRAVLTAAHCLTDRYKASMNPRGIRVVFGHITRLAVYDESDFR-SVDRLV 124
            :..||||||.||::|...:||:|||..|:.|.....|.:.||.|...||......... .|.::.
  Fly    71 KLFGDNHFCGGVIISRTYILTSAHCAMDKRKIVHRSRVLVVVAGTTNRLKSRKGLSLNMEVKKIF 135

  Fly   125 VHPEYERYKKNDLAILRLSERVQSSNHDVLPLLMRKTANVTYGDTCITLGWGQIYQHGPYSNELV 189
            |..::..:..|::|::.|::::...| .::.::...||:...|.....||||:|::.||.:::::
  Fly   136 VPDKFTVFNTNNIALMMLAKKLPLDN-PLVGVINLPTADPEPGLNYTVLGWGRIFKGGPLASDIL 199

  Fly   190 YLDVILRPPSLCQKHYDTFTADHNVCTEPVGESMN---CAGDMGGPLLCKGALFGLIGGHMGCAG 251
            ::||.|.|..:|:|....| .:..:|...:..:|:   ||||.|.||:....:||::...:|| |
  Fly   200 HIDVELLPRDICEKKVHIF-KEEMMCAGNLNNTMDENPCAGDTGSPLIFNETVFGVVSYRVGC-G 262

  Fly   252 GKAMK--FLSFLYYKDWI 267
            .|.:.  :.:...:.|||
  Fly   263 SKTLPSIYTNVYMHMDWI 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15873NP_611910.2 Tryp_SPc 36..250 CDD:214473 67/219 (31%)
Tryp_SPc 59..250 CDD:238113 57/194 (29%)
CG18223NP_649077.1 Tryp_SPc 60..283 CDD:238113 68/224 (30%)
Tryp_SPc 60..280 CDD:214473 66/222 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436951
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H117632
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008551
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.