DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15873 and CG7542

DIOPT Version :9

Sequence 1:NP_611910.2 Gene:CG15873 / 37898 FlyBaseID:FBgn0035003 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_001287099.1 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster


Alignment Length:222 Identity:58/222 - (26%)
Similarity:95/222 - (42%) Gaps:35/222 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 FCSGVLVSSRAVLTAAHCLTDRYKASMNPRGIRVVFGHITRLAVYDESDFRSVDR-------LVV 125
            :|.|.|:|...::|||||:.          |...|..::..:.:.|||: ...:|       ::|
  Fly    54 WCGGTLISHYWIITAAHCMD----------GAESVTVYLGAINIGDESE-EGQERIMVEKSGIIV 107

  Fly   126 HPEY-ERYKKNDLAILRL------SERVQSSNHDVLPLLMRKTANVTYGDTCITLGWG-QIYQHG 182
            |..| .....||::::||      ::|:::::   ||..:...............||| :.....
  Fly   108 HSNYMASTVVNDISLIRLPAFVGFTDRIRAAS---LPRRLNGQFPTYESIRAFASGWGRESDASD 169

  Fly   183 PYSNELVYLDVILRPPSLCQKHYDTFTADHNVCTEPVGESMNCAGDMGGPLLCK-GALFGLIGG- 245
            ..|..|.|:::.:.|.|||:.::....::..:|.........|.||.||||:.| |....|||. 
  Fly   170 SVSPVLRYVEMPIMPHSLCRMYWSGAVSEKMICMSTTSGKSTCHGDSGGPLVYKQGNSSYLIGST 234

  Fly   246 ----HMGCAGGKAMKFLSFLYYKDWIL 268
                .|||..|....|.....|.||||
  Fly   235 SFGTSMGCQVGFPAVFTRISSYLDWIL 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15873NP_611910.2 Tryp_SPc 36..250 CDD:214473 50/202 (25%)
Tryp_SPc 59..250 CDD:238113 50/202 (25%)
CG7542NP_001287099.1 Tryp_SPc 27..263 CDD:238113 58/222 (26%)
Tryp_SPc 27..260 CDD:214473 55/219 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471180
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.