DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15873 and Jon74E

DIOPT Version :9

Sequence 1:NP_611910.2 Gene:CG15873 / 37898 FlyBaseID:FBgn0035003 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster


Alignment Length:300 Identity:80/300 - (26%)
Similarity:120/300 - (40%) Gaps:71/300 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQILTVFLGLIL---STSLSDADLG-VIGDISDETFEMLISGGYKPKSNRLSRHV-VSIRTKNYV 60
            |||.|:.:.|::   ..|:|..|:| .||.        .|:||...::|:....| :||...|  
  Fly     1 MQISTILVFLLILVQGRSISCLDMGHGIGG--------RIAGGELARANQFPYQVGLSIEEPN-- 55

  Fly    61 RHRGDNH-FCSGVLVSSRAVLTAAHCLTDRYKASMNPRGIRVVFGHITRLAVYDESDFRSVDRLV 124
                |.: :|...|:|.|.:||||||:.   ||.    .|....|.:.|||  .....||.:..|
  Fly    56 ----DMYCWCGASLISDRYLLTAAHCVE---KAV----AITYYLGGVLRLA--PRQLIRSTNPEV 107

  Fly   125 -VHPEYE-RYKKNDLAILRLSERV----------------QSSNHDVLPLLMRKTANVTYGDTCI 171
             :||::. :..:||:|::||.|..                ..:::|.:|              .|
  Fly   108 HLHPDWNCQSLENDIALVRLPEDALLCDSIRPIRLPGLSSSRNSYDYVP--------------AI 158

  Fly   172 TLGWGQIYQHG-PYSNELVYLDVILRPPSLCQKHYDTFTADHNVCTEPVGESMNCAGDMGGPLLC 235
            ..|||::.... ..|:.|.|:...:.....|:..|...... |:|.:..|....|.||.||||:.
  Fly   159 ASGWGRMNDESTAISDNLRYVYRFVESNEDCEYSYANIKPT-NICMDTTGGKSTCTGDSGGPLVY 222

  Fly   236 K------GALFGL--IGGHMGCAGGKAMKFLSFLYYKDWI 267
            .      ..|.|:  .|...||..|....|.....|.|||
  Fly   223 SDPVQNADILIGVTSYGKKSGCTKGYPSVFTRITAYLDWI 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15873NP_611910.2 Tryp_SPc 36..250 CDD:214473 62/242 (26%)
Tryp_SPc 59..250 CDD:238113 54/218 (25%)
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 67/260 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.