DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15873 and CG8329

DIOPT Version :9

Sequence 1:NP_611910.2 Gene:CG15873 / 37898 FlyBaseID:FBgn0035003 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_648339.1 Gene:CG8329 / 39123 FlyBaseID:FBgn0036022 Length:259 Species:Drosophila melanogaster


Alignment Length:253 Identity:61/253 - (24%)
Similarity:96/253 - (37%) Gaps:56/253 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 LISGGYKPKSNRLSRHVVSIRTKNYVRHRGDNHFCSGVLVSSRAVLTAAHCLTDRYKASMNPRGI 99
            :|..|| |.....:.:.|.:|..|       .....|.::.:..|||||||||.. ..:::....
  Fly    34 IIVNGY-PAYEGKAPYAVGLRMNN-------GAVGGGSVIGNNWVLTAAHCLTTD-SVTIHYGSN 89

  Fly   100 RVVFGHITRLAVYDESDFRSVDRLVVHPEYERYKKNDLAILR--------LSERVQSSNHDVLPL 156
            |...|.:.. .|...:.||       ||.|.....:|:.::|        |..:|.      ||.
  Fly    90 RAWNGQLQH-TVNKNNFFR-------HPGYPNSAGHDIGLIRTPYVSFTNLINKVS------LPK 140

  Fly   157 LMRKTANVTYGDT-----CITLGWGQIYQHGPYSNELVYLDVILRPPSLCQKHYDTFTADHNVCT 216
            ..:|      |:.     |:..|||.: .:|..::.|..:||.:.....|.:.|.: .|..::||
  Fly   141 FSQK------GERFENWWCVACGWGGM-ANGGLADWLQCMDVQVISNGECARSYGS-VASTDMCT 197

  Fly   217 EPVGESMNCAGDMGGPLLCK------GAL-FGLIGGHMGCAGGKAMKFLSFLYYKDWI 267
            ........|.||.||.|:..      |.: |..||...|.:|     :.....:.|||
  Fly   198 RATDGKSVCGGDSGGALVTHDNPIQVGVITFASIGCKSGPSG-----YTRVSDHLDWI 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15873NP_611910.2 Tryp_SPc 36..250 CDD:214473 57/233 (24%)
Tryp_SPc 59..250 CDD:238113 50/210 (24%)
CG8329NP_648339.1 Tryp_SPc 35..253 CDD:238113 61/252 (24%)
Tryp_SPc 35..250 CDD:214473 59/250 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471187
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.