DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15873 and CG33460

DIOPT Version :9

Sequence 1:NP_611910.2 Gene:CG15873 / 37898 FlyBaseID:FBgn0035003 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_001033949.1 Gene:CG33460 / 3885588 FlyBaseID:FBgn0053460 Length:275 Species:Drosophila melanogaster


Alignment Length:194 Identity:46/194 - (23%)
Similarity:77/194 - (39%) Gaps:55/194 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 HRGDNHFCSGVLVSSRAVLTAAHCLTDRYKASMNPRGIRVVFGHITRLAVYDESDFRSVDRLVVH 126
            |...:.||:|.|::...:||||.|:        .|..::|..|...|   |...  ...|.||.:
  Fly    50 HTDGSIFCAGTLITDVFILTAASCI--------RPNAVKVRLGEFGR---YPNE--LPEDHLVHY 101

  Fly   127 PEYERYK-------KNDLAILRLSERVQSSNHDVLPL------------LMRKTANVTYGDTCIT 172
              :..|:       .|::.:|:|::|||.::: ::|:            .||...|....|:.::
  Fly   102 --FLMYRLFNNESLANNIGLLKLTKRVQITDY-IMPVCIVLNPQNQQLSTMRFIGNAWMEDSNVS 163

  Fly   173 LGWGQIYQHGPYSNELVYLDVILRPPSLCQK--HYDTFTADHNVCTEPVGESMNCAGDMGGPLL 234
            |           :.||..: ||...|.:|..  .|..|.|.|.      |...:|.|..|..|:
  Fly   164 L-----------TKELRPI-VIQSKPKMCTNLDLYTQFCAGHQ------GNLRSCDGLTGSALI 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15873NP_611910.2 Tryp_SPc 36..250 CDD:214473 46/194 (24%)
Tryp_SPc 59..250 CDD:238113 46/194 (24%)
CG33460NP_001033949.1 Tryp_SPc 44..252 CDD:304450 46/194 (24%)
Tryp_SPc 44..249 CDD:214473 46/194 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436730
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.