DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15873 and CG33465

DIOPT Version :9

Sequence 1:NP_611910.2 Gene:CG15873 / 37898 FlyBaseID:FBgn0035003 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster


Alignment Length:318 Identity:67/318 - (21%)
Similarity:115/318 - (36%) Gaps:96/318 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LGLILSTSLSDADLGVIGDISDETFEMLISGGYKPK-SNRLSRHVVSIRTKNYVR--HRGDNHFC 69
            :||:|...|:               ::|....:.|| |..::.:..:..|..::.  ::.:...|
  Fly    10 IGLVLCQGLA---------------QLLDKKCHDPKTSENINFNHGATETAPWMASIYKNNQFIC 59

  Fly    70 SGVLVSSRAVLTAAHCLTDRYKASMNPRGIRVVFGHITRLAVYDESDFRSVDR--LVVHPEYERY 132
            .|.||....|||||.|::   |.|.    :.|:||...:..  |.|.|.:.::  :.|..::..:
  Fly    60 DGTLVHKLFVLTAASCIS---KDSQ----LYVLFGMYNQYR--DASQFFNNEQYGVAVALQHSNF 115

  Fly   133 KK----NDLAILRLSERVQSSNHDVLPLLMRKTANVTYGDTCITL---------------GWGQI 178
            :.    ||:.:|||...|....| :.|:             ||.|               ||   
  Fly   116 RPNNGVNDIGLLRLYGEVTHYAH-IRPI-------------CIILDHVVKSAPFERFEGFGW--- 163

  Fly   179 YQHGPYSNELVYLDVIL--RPPSLCQKHYDTFTADHNVCTEPVGESMNCAG---------DMGGP 232
            .|.|..::..|...|.|  :.|..|.::....         |:.|...|||         :.|.|
  Fly   164 QQQGTEASSQVRQTVYLSQKKPFECHRNGQLL---------PINEGQFCAGNRDRSFCRSNSGSP 219

  Fly   233 LLCK--------GALFGLIG-GHMGCAGGKAMKFLSFLYYKDWILLTIQSLSDCGVRV 281
            |...        ....||:. |...|:  ....:...:.:||||..|:::....|.:|
  Fly   220 LTADFTYGVKNITVQVGLVSYGSELCS--PTSVYTDVVAFKDWIYNTVRNFETKGDQV 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15873NP_611910.2 Tryp_SPc 36..250 CDD:214473 54/257 (21%)
Tryp_SPc 59..250 CDD:238113 50/233 (21%)
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 55/254 (22%)
Tryp_SPc 46..261 CDD:214473 53/251 (21%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436739
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.