DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15873 and CG10469

DIOPT Version :9

Sequence 1:NP_611910.2 Gene:CG15873 / 37898 FlyBaseID:FBgn0035003 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster


Alignment Length:250 Identity:64/250 - (25%)
Similarity:117/250 - (46%) Gaps:36/250 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LGLILSTSLSDADLGVIGDISDETFEMLISGGYKPKSNRLSRHVVSIRTKNYVRHRGDNHFCSGV 72
            |.||:..||      |.|   .||..:.|..|...|:.:|...|..:  ..:...:.:.:.|.|.
  Fly     5 LVLIVQFSL------VFG---QETGSLRIMNGTAAKAKQLPYQVGLL--CYFEGSKDEPNMCGGT 58

  Fly    73 LVSSRAVLTAAHCLTDRYKASMNPR-GIRVVFGHITRLAVYDESDFRSVDR--LVVHPEYERYK- 133
            ::|:|.::||||||.|       |: .:..|..|:.::..:|:.:. .|:|  .:||.:::|.. 
  Fly    59 ILSNRWIITAAHCLQD-------PKSNLWKVLIHVGKVKSFDDKEI-VVNRSYTIVHKKFDRKTV 115

  Fly   134 KNDLAILRLSERVQSSNHDVLPLLMRKTANVTY-GDTCITLGWGQIYQHGPYSNELVYLDVILRP 197
            .||:|:::|.::: :.|..:.|..: .:|..|| |...|..|||...:..| |..|.|:...:..
  Fly   116 TNDIALIKLPKKL-TFNKYIQPAKL-PSAKKTYTGRKAIISGWGLTTKQLP-SQVLQYIRAPIIS 177

  Fly   198 PSLCQKHYD------TFTADHN--VCTEPVGESMNCAGDMGGPLLCKGALFGLIG 244
            ...|::.::      :....||  :|.:. .:.:.|.||.|||::.......|:|
  Fly   178 NKECERQWNKQLGGKSKKVVHNGFICIDS-KKGLPCRGDSGGPMVLDDGSRTLVG 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15873NP_611910.2 Tryp_SPc 36..250 CDD:214473 54/221 (24%)
Tryp_SPc 59..250 CDD:238113 49/198 (25%)
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 54/222 (24%)
Tryp_SPc 24..260 CDD:238113 54/221 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471194
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.