DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15873 and CG6592

DIOPT Version :9

Sequence 1:NP_611910.2 Gene:CG15873 / 37898 FlyBaseID:FBgn0035003 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster


Alignment Length:221 Identity:64/221 - (28%)
Similarity:97/221 - (43%) Gaps:32/221 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 HFCSGVLVSSRAVLTAAHCLTDRYKASMNPRGIRVV-----FGHITRLAVYDESDFRSVDRLVVH 126
            ::|.|.|:|.:.|:|||||: |..|.::...|...:     .|.: ||.|..|:       ..::
  Fly   149 YWCGGSLISDKHVITAAHCV-DMAKRALVFLGANEIKNAKEKGQV-RLMVPSEN-------FQIY 204

  Fly   127 PEYE-RYKKNDLAILRLSERVQSSNHDVLPLLMRKTANVTY----GDTCITLGWGQIYQHGPY-- 184
            |.:. :..|:|:||:||...| |.|..:.|:.:.| .:..|    ....|..|||: |..|.:  
  Fly   205 PTWNPKRLKDDIAIVRLPHAV-SFNERIHPIQLPK-RHYEYRSFKNKLAIASGWGR-YATGVHAI 266

  Fly   185 SNELVYLDVILRPPSLCQKHYDTFTADHNVCTEPVGESMNCAGDMGGPLLC------KGALFGL- 242
            ||.|.|:.:.:.....|:.::.......|:||........|.||.||||:.      |..|.|: 
  Fly   267 SNVLRYVQLQIIDGRTCKSNFPLSYRGTNICTSGRNARSTCNGDSGGPLVLQRRHSKKRVLVGIT 331

  Fly   243 -IGGHMGCAGGKAMKFLSFLYYKDWI 267
             .|...||..|....|.....|.|||
  Fly   332 SFGSIYGCDRGYPAAFTKVASYLDWI 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15873NP_611910.2 Tryp_SPc 36..250 CDD:214473 57/202 (28%)
Tryp_SPc 59..250 CDD:238113 57/202 (28%)
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 62/219 (28%)
Tryp_SPc 123..359 CDD:238113 64/221 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471203
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.