DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15873 and Jon65Aii

DIOPT Version :9

Sequence 1:NP_611910.2 Gene:CG15873 / 37898 FlyBaseID:FBgn0035003 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_648014.1 Gene:Jon65Aii / 38684 FlyBaseID:FBgn0035666 Length:259 Species:Drosophila melanogaster


Alignment Length:246 Identity:60/246 - (24%)
Similarity:99/246 - (40%) Gaps:45/246 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 ISGGYKPKSNRLSRHVVSIRTKNYVRHRGDNHFCSGVLVSSRAVLTAAHCLTDRYKASMNPRGIR 100
            |:.||.....::. ::|::|..|   ..|...:|.|.::....|||||||   .|.||.    :.
  Fly    37 ITNGYPAYEGKVP-YIVALRFDN---GNGGGWYCGGSIIGHEWVLTAAHC---TYGASY----VT 90

  Fly   101 VVFGHITRLAVYDESDFRSVDRLVVHPEYERYKKNDLAILR--------LSERVQSSNHDVLPLL 157
            :.:|.:.|    .:..|...|...:|        ||:|::|        |..:|:...:|     
  Fly    91 ISYGAVWR----QQPQFTHYDTGNLH--------NDIALIRTPHVDFWSLVNKVELPRYD----- 138

  Fly   158 MRKTANVTYGDTCITLGWGQIYQHGPYSNELVYLDVILRPPSLCQKHYDT--FTADHNVCTEPVG 220
              ...|..||...:..|||........::.|..:|:.:...|:|..:|.:  .|::| :|.....
  Fly   139 --DRYNNFYGWWALLSGWGSSSDSSGMTDYLNCVDIQISDNSVCLDYYGSHYITSNH-LCYATPE 200

  Fly   221 ESMNCAGDMGGPLLCK--GALFGLI--GGHMGCAGGKAMKFLSFLYYKDWI 267
            ...:|:||.||||:..  ....|::  |...||.............|.|||
  Fly   201 NKGSCSGDSGGPLVLHDGNRQVGIVSFGSAAGCLSNSPKGLTRVTGYLDWI 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15873NP_611910.2 Tryp_SPc 36..250 CDD:214473 55/227 (24%)
Tryp_SPc 59..250 CDD:238113 49/204 (24%)
Jon65AiiNP_648014.1 Tryp_SPc 36..251 CDD:214473 58/244 (24%)
Tryp_SPc 37..254 CDD:238113 60/246 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471188
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.