DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15873 and Jon65Aiii

DIOPT Version :9

Sequence 1:NP_611910.2 Gene:CG15873 / 37898 FlyBaseID:FBgn0035003 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_648013.1 Gene:Jon65Aiii / 38683 FlyBaseID:FBgn0035665 Length:274 Species:Drosophila melanogaster


Alignment Length:293 Identity:72/293 - (24%)
Similarity:112/293 - (38%) Gaps:53/293 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQILTVFLGLILSTS----------LSDADLGVIGDISDETFEMLISGGYKPKSNRLSRHV-VSI 54
            |::|.|| .|.|:|:          :...||..:.:|     |..|:.|....|.:....| :|.
  Fly     1 MKVLVVF-ALALATASAGLLPQQVPIHPRDLPAVTNI-----EGRITNGKTATSGQFPYQVGLSF 59

  Fly    55 RTKNYVRHRGDNHFCSGVLVSSRAVLTAAHCLTDRYKASMNPRGIRVVFGHITRLAVYDESDFRS 119
            .:.:      .:.:|.|.::.:..|||||||       :.....:.:.:|...|.:....... |
  Fly    60 ASTS------GSWWCGGSIIDNTWVLTAAHC-------TSGASAVTIYYGATVRTSAQLVQTV-S 110

  Fly   120 VDRLVVHPEYER-YKKNDLAILR--------LSERVQSSNHDVLPLLMRKTANVTYGDTCITLGW 175
            .|..|.|..|.. ..:||:::::        |..:|:      ||.:....:..| |...|..||
  Fly   111 ADNFVQHASYNSIVLRNDISLIKTPTVAFTALINKVE------LPAIAGTYSTYT-GQQAIASGW 168

  Fly   176 GQIYQHG-PYSNELVYLDVILRPPSLCQKHYDTFTADHNV-CTEPVGESMNCAGDMGGP--LLCK 236
            |:..... ..:|.|.|....:...|.||..|.:..|.:|| |.....:...|.||.|||  |:..
  Fly   169 GKTSDSATSVANTLQYEVFEVVSVSQCQNTYGSLVATNNVICVATPNKVSTCNGDSGGPLVLVSD 233

  Fly   237 GALFGLIG--GHMGCAGGKAMKFLSFLYYKDWI 267
            ..|.|:..  ...||..|....|.....|.|||
  Fly   234 SKLIGVTSFVSSAGCESGAPAGFTRVTSYLDWI 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15873NP_611910.2 Tryp_SPc 36..250 CDD:214473 54/229 (24%)
Tryp_SPc 59..250 CDD:238113 49/205 (24%)
Jon65AiiiNP_648013.1 Tryp_SPc 39..266 CDD:214473 59/247 (24%)
Tryp_SPc 40..269 CDD:238113 61/248 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471204
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.