DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15873 and Jon65Aiv

DIOPT Version :9

Sequence 1:NP_611910.2 Gene:CG15873 / 37898 FlyBaseID:FBgn0035003 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_648012.1 Gene:Jon65Aiv / 38682 FlyBaseID:FBgn0250815 Length:271 Species:Drosophila melanogaster


Alignment Length:258 Identity:68/258 - (26%)
Similarity:107/258 - (41%) Gaps:29/258 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 DLGVIGDISDETFEMLISGGYKPKSNRLSRHV-VSIRTKNYVRHRGDNHFCSGVLVSSRAVLTAA 83
            ::.|:|||...     |:||......:....| :|::....     .:.:|.|.|:.|..|||||
  Fly    27 EMPVVGDIGGR-----ITGGSNAAVGQFPYQVGLSLKLSAL-----SSAWCGGSLIGSTWVLTAA 81

  Fly    84 HCLTDRYKASMNPRGIRVVFGHITRLAVYDESDFRSVDRLVVHPEYERYK-KNDLAILRLSERVQ 147
            || ||      ..:.:.|..|...|.:........|.| :::|..:.... :||::::::.....
  Fly    82 HC-TD------GVQSVTVYLGATVRTSAEITHTVSSSD-IIIHSGWNSANLRNDISLIKIPATSS 138

  Fly   148 SSNHDVLPLLMRKTANVTY-GDTCITLGWGQI--YQHGPYSNELVYLDVILRPPSLCQKHYDT-F 208
            ||....:.|.....:..|: ||..:..|||:.  ...|..:| |.|:|:.:...:.|.:.|.| .
  Fly   139 SSRISAVKLPSISNSYSTFVGDVAVASGWGRTSDTSSGVATN-LQYVDLTVITNTKCAQTYGTSV 202

  Fly   209 TADHNVCTEPVGESMNCAGDMGGPLLCKGA--LFGL--IGGHMGCAGGKAMKFLSFLYYKDWI 267
            ..|..:|.........|.||.||||:.|.:  ..||  .|...||..|....|.....|.|||
  Fly   203 VTDSTLCVATTDAKSTCNGDSGGPLVLKSSSEQIGLTSFGASAGCEKGYPAAFTRVTSYLDWI 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15873NP_611910.2 Tryp_SPc 36..250 CDD:214473 57/223 (26%)
Tryp_SPc 59..250 CDD:238113 52/199 (26%)
Jon65AivNP_648012.1 Tryp_SPc 37..265 CDD:214473 62/246 (25%)
Tryp_SPc 38..268 CDD:238113 64/242 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471195
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.