DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15873 and yip7

DIOPT Version :9

Sequence 1:NP_611910.2 Gene:CG15873 / 37898 FlyBaseID:FBgn0035003 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster


Alignment Length:293 Identity:76/293 - (25%)
Similarity:119/293 - (40%) Gaps:58/293 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LTVFLGLILSTSLSDADLGVIGDIS-----DETFEMLISG----------GYKPKSNRLSRHVVS 53
            :.||:.|:|  :|:.|..|::.:|:     |......|:|          |..|....||     
  Fly     1 MKVFVVLVL--ALASASAGLLPNIAPVHPRDRVSTPSITGRITNGKDAVAGQFPYQVGLS----- 58

  Fly    54 IRTKNYVRHRGDNHFCSGVLVSSRAVLTAAHCLTDRYKASMNPRGIRVVFGHITRLA-----VYD 113
                  ......:.:|.|.::.:..||||||| ||      ....:.:.:|...|.:     |..
  Fly    59 ------FSSSAGSWWCGGSIIGNEWVLTAAHC-TD------GAASVTIYYGATVRTSPEFTQVVS 110

  Fly   114 ESDFRSVDRLVVHPEYERYK----KNDLAILRLSERVQSSNHDVLPLLMRKTANVTY-GDTCITL 173
            .|.||         ::|.|.    :||:::::.|....|:..:.:.|.....:..|| |.|.:..
  Fly   111 SSKFR---------QHESYLALTIRNDISLIQTSSVSFSATVNKISLPAVSNSYSTYEGKTAVAS 166

  Fly   174 GWGQIY-QHGPYSNELVYLDVILRPPSLCQKHYDTFTADHNV-CTEPVGESMNCAGDMGGPLLCK 236
            |||... |....|.:|.|:|:.:...|.||:.:.:......| |.:...::..|.||.||||...
  Fly   167 GWGLTSDQATAVSRDLQYVDLTIISNSKCQETFGSLIVTSRVLCVDTTNKASTCQGDSGGPLALD 231

  Fly   237 GALFGL--IGGHMGCAGGKAMKFLSFLYYKDWI 267
            |.|.|.  .|...||..|....|....||:|||
  Fly   232 GVLIGATSFGSADGCESGAPAAFTRITYYRDWI 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15873NP_611910.2 Tryp_SPc 36..250 CDD:214473 59/237 (25%)
Tryp_SPc 59..250 CDD:238113 53/204 (26%)
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 63/251 (25%)
Tryp_SPc 40..267 CDD:238113 65/252 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471183
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.