DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15873 and CG10477

DIOPT Version :9

Sequence 1:NP_611910.2 Gene:CG15873 / 37898 FlyBaseID:FBgn0035003 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_001303385.1 Gene:CG10477 / 38679 FlyBaseID:FBgn0035661 Length:272 Species:Drosophila melanogaster


Alignment Length:285 Identity:65/285 - (22%)
Similarity:112/285 - (39%) Gaps:42/285 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LTVFLGLILSTSLSDADLGVIGDISDET------------FEMLISGGYKPKSNRLSRHV-VSIR 55
            :.||..|:|:.:...||:     :..:|            .:..|:.|.|..:|:....| :|.:
  Fly     1 MKVFAVLVLAIATVSADI-----LRQDTPVHPRDSSAVPSIDGRITNGNKAAANQFPYQVGLSFK 60

  Fly    56 TKNYVRHRGDNHFCSGVLVSSRAVLTAAHCLTDRYKASMNPRGIRVVFGHITRLAVYDESDFRSV 120
            :.      ..:.:|.|.::::..|||||||       :.....:.:.:|...|.:...:....| 
  Fly    61 SS------AGSWWCGGSIIANTWVLTAAHC-------TKGASSVTIYYGSTVRTSAKLKKKVSS- 111

  Fly   121 DRLVVHPEYERYK-KNDLAILRLSE--RVQSSNHDVLPLLMRKTANVTY-GDTCITLGWGQIYQH 181
            .:.|.|..|.... :||:::::...  ...|.|...||.:  .::..|| |.|.:..|||:....
  Fly   112 SKFVQHAGYNAATLRNDISLIKTPSVTFTVSINKIALPAI--ASSYSTYAGQTAVASGWGRTSDS 174

  Fly   182 G-PYSNELVYLDVILRPPSLCQKHYDTFTADHNV-CTEPVGESMNCAGDMGGPLLCKGALFGLIG 244
            . ..:..|.|....:...::|||.:.:......| |.|.:.:...|.||.||||.....|.|:..
  Fly   175 SIAVATNLQYAQFQVITNAVCQKTFGSSVVTSGVICVESINKKSTCQGDSGGPLALNNRLIGVTS 239

  Fly   245 --GHMGCAGGKAMKFLSFLYYKDWI 267
              ...||.......|.....|.|||
  Fly   240 FVSSKGCEKNAPAGFTRVTSYLDWI 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15873NP_611910.2 Tryp_SPc 36..250 CDD:214473 52/222 (23%)
Tryp_SPc 59..250 CDD:238113 46/198 (23%)
CG10477NP_001303385.1 Tryp_SPc 39..264 CDD:214473 56/240 (23%)
Tryp_SPc 40..267 CDD:238113 58/241 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471192
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.