DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15873 and Jon25Biii

DIOPT Version :9

Sequence 1:NP_611910.2 Gene:CG15873 / 37898 FlyBaseID:FBgn0035003 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_608881.1 Gene:Jon25Biii / 33706 FlyBaseID:FBgn0031653 Length:258 Species:Drosophila melanogaster


Alignment Length:290 Identity:61/290 - (21%)
Similarity:104/290 - (35%) Gaps:63/290 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQILTVFLGLILSTSLSDADLGVIGDISDETFEMLISGGYKPKSNRLSRHVVSIRTKNYVRHRG- 64
            |::....|.|.::::.:..:...:.|:              ||:.::...:    |..|....| 
  Fly     1 MKVFLAILALAVASASAFDEKVFVKDL--------------PKATKIEGRI----TNGYAAPEGK 47

  Fly    65 ----------DNHFCSGVLVSSRAVLTAAHCLTDRYKASMNPRGIRVVFGHITRLAVYDESDFRS 119
                      ...:|.|.:::...||||.||:.|       ...:.|.||...|    ..:.|  
  Fly    48 APYTVGLGFSGGWWCGGSIIAHDWVLTAEHCIGD-------AASVIVYFGATWR----TNAQF-- 99

  Fly   120 VDRLVVHPEYERYKKNDLAILRLSERVQSSNHDVLPLLMRKTANVTYGDT--------CITLGWG 176
             ...|.:..:.::...|:|::|:.       |.....::.|....:|.|.        .:..|||
  Fly   100 -THTVGNGNFIKHSNADIALIRIP-------HVDFWHMVNKVELPSYNDRYNNYNEWWAVACGWG 156

  Fly   177 QIYQHGPYSNELVYLDVILRPPSLCQKHYDTFTADHNVCTEPVGESMNCAGDMGGPLLCK--GAL 239
            ..|...|..:.|..:|:.:.....|...|.: ..|:.:||..|.....|.||.||||:..  ..|
  Fly   157 GTYDGSPLPDWLQCVDLQIVHNEECGWTYGS-VGDNVICTRTVDGKSICGGDSGGPLVTHDGSKL 220

  Fly   240 FGLIG--GHMGCAGGKAMKFLSFLYYKDWI 267
            .|:..  ...||..|....|....|:.|||
  Fly   221 VGVSNFVSSNGCQSGAPAGFQRVTYHLDWI 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15873NP_611910.2 Tryp_SPc 36..250 CDD:214473 50/236 (21%)
Tryp_SPc 59..250 CDD:238113 47/213 (22%)
Jon25BiiiNP_608881.1 Tryp_SPc 36..250 CDD:214473 53/239 (22%)
Tryp_SPc 37..253 CDD:238113 55/240 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471207
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.