DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15873 and psh

DIOPT Version :9

Sequence 1:NP_611910.2 Gene:CG15873 / 37898 FlyBaseID:FBgn0035003 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_573297.1 Gene:psh / 32832 FlyBaseID:FBgn0030926 Length:394 Species:Drosophila melanogaster


Alignment Length:241 Identity:68/241 - (28%)
Similarity:99/241 - (41%) Gaps:43/241 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 ISGGYKPKSNRLSRHVVSIRTKNYVRHRGDNHFCSGVLVSSRAVLTAAHCL-TDRYKASMNPRGI 99
            |.||| |....:..|:.:|   .|:.. |.:..|.|.|::||.|||||||: ||    :..|..:
  Fly   144 IVGGY-PVDPGVYPHMAAI---GYITF-GTDFRCGGSLIASRFVLTAAHCVNTD----ANTPAFV 199

  Fly   100 RVVFGHITRLAVYDESDFRSVDRLV-----VHPEYERYKKNDLAILRLSERVQSSNHDVLPLLMR 159
            |:.       ||..|:...|...:|     :||:|...|.||:|||.| ||......::.|..:.
  Fly   200 RLG-------AVNIENPDHSYQDIVIRSVKIHPQYVGNKYNDIAILEL-ERDVVETDNIRPACLH 256

  Fly   160 KTA-NVTYGDTCITLGWGQI-YQHGPYSNELVYLDVILRPPSLCQKHYDTFTADHNVCTEPVGES 222
            ..| :..........|||.: ......|..|:...:.|.|...|...|........:..:.|.:|
  Fly   257 TDATDPPSNSKFFVAGWGVLNVTTRARSKILLRAGLELVPLDQCNISYAEQPGSIRLLKQGVIDS 321

  Fly   223 MNCA-----------GDMGGPLLCK-------GALFGLIGGHMGCA 250
            :.||           ||.||||:.:       ..:.|:|....|||
  Fly   322 LLCAIDQKLIADACKGDSGGPLIHELNVEDGMYTIMGVISSGFGCA 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15873NP_611910.2 Tryp_SPc 36..250 CDD:214473 66/239 (28%)
Tryp_SPc 59..250 CDD:238113 59/216 (27%)
pshNP_573297.1 CLIP 30..79 CDD:197829
Tryp_SPc 143..384 CDD:214473 68/241 (28%)
Tryp_SPc 144..387 CDD:238113 68/241 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437093
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.