DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15873 and Hayan

DIOPT Version :9

Sequence 1:NP_611910.2 Gene:CG15873 / 37898 FlyBaseID:FBgn0035003 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_001097020.1 Gene:Hayan / 32831 FlyBaseID:FBgn0030925 Length:637 Species:Drosophila melanogaster


Alignment Length:292 Identity:72/292 - (24%)
Similarity:111/292 - (38%) Gaps:88/292 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 EMLISGGYKP------KSNRLSR----HVVSIRTKNYVRHRGDNHF-CSGVLVSSRAVLTAAHCL 86
            |.:.||| ||      ...|:.|    |:.:|...::    |...| |.|.|::||.|||||||:
  Fly   372 EKIRSGG-KPLTVHILDGERVDRGVYPHMAAIAYNSF----GSAAFRCGGSLIASRFVLTAAHCV 431

  Fly    87 TDRYKASMNPRGIRVVFGHITRLAVYDESDFRSVD--RLVVHPEYERYKK-NDLAILRLSERVQS 148
            .   .....|..:|:...:|..    .|..::.::  .:.:||:|....| .|:|||:|:|..:.
  Fly   432 N---SDDSTPSFVRLGALNIEN----PEPGYQDINVIDVQIHPDYSGSSKYYDIAILQLAEDAKE 489

  Fly   149 S--------------------------------NHDVLPLLMRKTANVTYGDTCITLGWGQIYQH 181
            |                                |..|..:|:|...::...|.|     ...:..
  Fly   490 SDVIRPACLYTDRSDPPANYKYFVAGWGVMNVTNRAVSKILLRAALDLVPADEC-----NASFAE 549

  Fly   182 GPYSNELVYLDVILRPPSLCQKHYDTFTADHNVCTEPVGESMNCAGDMGGPLLCK-------GAL 239
            .|.:|..:...||  ...||       .||.|...:.      |.||.||||:.:       .::
  Fly   550 QPSANRTLRRGVI--ASQLC-------AADKNQRKDA------CQGDSGGPLILEIDDVDGTYSI 599

  Fly   240 FGLIGGHMGCA---GGKAMKFLSFLYYKDWIL 268
            .|:|....|||   .|...:..|||.|.:.|:
  Fly   600 VGVISSGFGCATKTPGLYTRVSSFLDYIEGIV 631

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15873NP_611910.2 Tryp_SPc 36..250 CDD:214473 63/266 (24%)
Tryp_SPc 59..250 CDD:238113 54/233 (23%)
HayanNP_001097020.1 CLIP 32..80 CDD:197829
Tryp_SPc 384..627 CDD:214473 64/273 (23%)
Tryp_SPc 385..630 CDD:238113 65/275 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437094
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.