DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15873 and CG31220

DIOPT Version :9

Sequence 1:NP_611910.2 Gene:CG15873 / 37898 FlyBaseID:FBgn0035003 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_732440.2 Gene:CG31220 / 326126 FlyBaseID:FBgn0051220 Length:363 Species:Drosophila melanogaster


Alignment Length:278 Identity:69/278 - (24%)
Similarity:105/278 - (37%) Gaps:70/278 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 ISGGYKPKSNRLSRHVVSIRTKNYVRHRGDNHF---CSGVLVSSRAVLTAAHCLTD--------- 88
            :.||.:|..|... .:..:..:|......|...   |.|.|:::|.|||||||:||         
  Fly   104 VIGGTEPNLNEYP-WLAMLLYRNRSAFNPDRELVPSCGGSLINTRYVLTAAHCVTDTVLQIQRVR 167

  Fly    89 --RYKASMNP----RGIRVVFGHITRLAVYDESDFRSVDRLVVHPEYE--RYK-KNDLAILRLSE 144
              .:..|.||    ||.|:|... |.|.:       .|:.:..|.:|:  .|. :||:|::||.|
  Fly   168 LGEHTTSHNPDCISRGARIVCAP-THLDI-------DVESITSHNDYDPANYTFRNDIALVRLKE 224

  Fly   145 RVQSSNHDVLPLLMRKTANVTYGDTCI-------------TLGWGQIYQHGPYSNELVYLDVILR 196
            .|:.:              :.|...|:             ..|||:.......|..|.:..|.:|
  Fly   225 PVRYT--------------MAYYPICVLDYPRSLMKFKMYVAGWGKTGMFDTGSKVLKHAAVKVR 275

  Fly   197 PPSLCQKHY--DTFTADHNVCTEPVGESMNCAGDMGGPLL-CKGALFGLI---------GGHMGC 249
            .|..|.:.|  ..|.....:|...:.....|.||.|.||: ..|..:..|         ||..|.
  Fly   276 KPEECSEKYAHRHFGPRFQICAGGLDNRGTCDGDSGSPLMGTSGRSYETITFLAGITSYGGPCGT 340

  Fly   250 AGGKAMKFLSFLYYKDWI 267
            .|..::...:..:|| ||
  Fly   341 IGWPSVFTRTAKFYK-WI 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15873NP_611910.2 Tryp_SPc 36..250 CDD:214473 64/259 (25%)
Tryp_SPc 59..250 CDD:238113 59/236 (25%)
CG31220NP_732440.2 Tryp_SPc 103..357 CDD:214473 67/276 (24%)
Tryp_SPc 104..360 CDD:238113 69/278 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436712
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.