DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15873 and sphinx1

DIOPT Version :9

Sequence 1:NP_611910.2 Gene:CG15873 / 37898 FlyBaseID:FBgn0035003 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_729255.2 Gene:sphinx1 / 318005 FlyBaseID:FBgn0052383 Length:253 Species:Drosophila melanogaster


Alignment Length:256 Identity:56/256 - (21%)
Similarity:103/256 - (40%) Gaps:49/256 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQILTVFLGLILSTSLSDADLGVIGDISDETFEMLISGGYKPKSNRLSRHVVSIRTKNYVRHRGD 65
            |:::...|.|.|:.|:.:.:          .....|:|||:.|:..:...|..:..|:   ....
  Fly     1 MKLVVTLLVLSLTVSVGEKN----------KLSPRIAGGYRAKTFTIIYLVGIVYFKS---QTSS 52

  Fly    66 NHFCSGVLVSSRAVLTAAHCLTDRY-----KASMNPRGIRVVFGHITRLAVYDES-----DFRSV 120
            .::.:|.::|::.:||....|...|     .:..:.||..::       .:|.|:     |...|
  Fly    53 LNYGAGTIISNQWILTVKTVLKYSYIEVHLASRRSYRGFDII-------RIYKENFRFHYDNDHV 110

  Fly   121 DRLVVHPEYERYKKNDLAILRLSERVQSSNHDVLPLLMRKTANVTYGDTCITLGWGQIYQHGPYS 185
            ..||..|    |:|.|    |..:||:...:|.  ...|...|:|     :..|:|...:|....
  Fly   111 IALVKCP----YQKFD----RRMDRVRVPAYDT--RFERYVGNMT-----MVCGYGTEKRHAKLP 160

  Fly   186 NELVYLDVILRPPSLCQKHYDTFTADHNVCTEPVGESMNCAGDMGGPLLCKG---ALFGLI 243
            ..:..::|.:...:.|.|:| |....:.:||...|....|.||:||.::..|   ...|:|
  Fly   161 EWMRCIEVEVMNNTECAKYY-TPLKWYEMCTSGEGFKGVCEGDIGGAVVTMGPNPTFIGII 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15873NP_611910.2 Tryp_SPc 36..250 CDD:214473 51/221 (23%)
Tryp_SPc 59..250 CDD:238113 44/198 (22%)
sphinx1NP_729255.2 Tryp_SPc 25..245 CDD:214473 51/222 (23%)
Tryp_SPc 26..248 CDD:304450 51/221 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471189
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.