DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15873 and CG11664

DIOPT Version :9

Sequence 1:NP_611910.2 Gene:CG15873 / 37898 FlyBaseID:FBgn0035003 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_569865.1 Gene:CG11664 / 31033 FlyBaseID:FBgn0040341 Length:254 Species:Drosophila melanogaster


Alignment Length:251 Identity:61/251 - (24%)
Similarity:105/251 - (41%) Gaps:43/251 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 VSIRTKNY---VRHRGDNHFCSGVLVSSRAVLTAAHCLTDRYKASMNPRGIRVVFGHITRLAVYD 113
            :.::.:||   ::..|.....:|.|.|:|.|||.|||    :|.:..|..:.|..|:  |...: 
  Fly    27 IPVQQQNYGYVMQIYGPQFLAAGSLFSARYVLTVAHC----FKKNTKPEELSVRAGY--RWIAW- 84

  Fly   114 ESDFR--SVDRLVVHPEYERYK-KNDLAILRLSERVQSS---------NHDVLPLLMRKTANVTY 166
              :||  .|..|:.||::.... :||:|:||:...:..|         :..:.||.|       :
  Fly    85 --EFRGKQVAGLLRHPKFSPLTLRNDIAVLRVKAAISHSHMINYIGLCSRPLTPLNM-------F 140

  Fly   167 GDTCITLGWGQIYQHGPYSNELVYLDVILRPPSLCQKHYDTFTADHNVCTEPVGESMNCAGDMGG 231
            .......||..::...|    |..:.|.:.|...|::.:...:......:..:||.: |.||.|.
  Fly   141 APPQELAGWNLMHIAQP----LKSMSVQVEPEKNCRQWFPQISGGVICASATMGEGL-CYGDSGD 200

  Fly   232 PLLCKGALFGLIGGHMGCAGGKAMK--FLSFLYYKDWILLTIQSLSDCGVRVSLSR 285
            ||:..|.:.||......| |.|...  |....|::.:|...:.:|.    |..||:
  Fly   201 PLISGGEVCGLAIAFRKC-GDKRYPALFTDVHYHRAFIAQAVLTLD----REMLSK 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15873NP_611910.2 Tryp_SPc 36..250 CDD:214473 51/212 (24%)
Tryp_SPc 59..250 CDD:238113 50/205 (24%)
CG11664NP_569865.1 Tryp_SPc 38..239 CDD:304450 55/222 (25%)
Tryp_SPc 38..237 CDD:214473 54/220 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.