DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15873 and GZMK

DIOPT Version :9

Sequence 1:NP_611910.2 Gene:CG15873 / 37898 FlyBaseID:FBgn0035003 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_002095.1 Gene:GZMK / 3003 HGNCID:4711 Length:264 Species:Homo sapiens


Alignment Length:251 Identity:74/251 - (29%)
Similarity:106/251 - (42%) Gaps:34/251 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 FEMLISGGYKPKSNRLSRHVVSIRTKNYVRHRGDNHFCSGVLVSSRAVLTAAHCLTDRYKASMNP 96
            |.|.|.|| |..|......:.||:       .|.:|.|.|||:..:.||||||| ..|:....:|
Human    23 FNMEIIGG-KEVSPHSRPFMASIQ-------YGGHHVCGGVLIDPQWVLTAAHC-QYRFTKGQSP 78

  Fly    97 RGIRVVFG------HITRLAVYDESDFRSVDRLVVHPEYERYKKNDLAILRLSERVQSSNHDVLP 155
               .||.|      :.......:...|....|:...|:     .||:.:::|....:.:.| |..
Human    79 ---TVVLGAHSLSKNEASKQTLEIKKFIPFSRVTSDPQ-----SNDIMLVKLQTAAKLNKH-VKM 134

  Fly   156 LLMRKTANVTYGDTCITLGWGQIYQHG--PYSNELVYLDVILRPPSLC--QKHY--DTFTADHNV 214
            |.:|...::..|..|...|||......  | |:.|..:.|.:....||  |.:|  |.|.....|
Human   135 LHIRSKTSLRSGTKCKVTGWGATDPDSLRP-SDTLREVTVTVLSRKLCNSQSYYNGDPFITKDMV 198

  Fly   215 CT-EPVGESMNCAGDMGGPLLCKGALFGLI-GGH-MGCAGGKAMKFLSFLYYKDWI 267
            |. :..|:..:|.||.||||:|||....:: ||| .|.|....:..|....|:.||
Human   199 CAGDAKGQKDSCKGDSGGPLICKGVFHAIVSGGHECGVATKPGIYTLLTKKYQTWI 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15873NP_611910.2 Tryp_SPc 36..250 CDD:214473 67/228 (29%)
Tryp_SPc 59..250 CDD:238113 60/205 (29%)
GZMKNP_002095.1 Tryp_SPc 26..254 CDD:214473 70/246 (28%)
Tryp_SPc 27..257 CDD:238113 72/247 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.