DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15873 and Mcpt2

DIOPT Version :9

Sequence 1:NP_611910.2 Gene:CG15873 / 37898 FlyBaseID:FBgn0035003 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_742041.1 Gene:Mcpt2 / 29266 RGDID:621058 Length:247 Species:Rattus norvegicus


Alignment Length:282 Identity:75/282 - (26%)
Similarity:115/282 - (40%) Gaps:42/282 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQILTVFLGLILSTSLSDADLGVIGDISDETFEMLISGGYK--PKSNRLSRHVVSIRTKNYVRHR 63
            ||.|...:.|:|.:          |..::|     |.||.:  |.|.....|:      :.|..:
  Rat     1 MQALLFLMALLLPS----------GAGAEE-----IIGGVESIPHSRPYMAHL------DIVTEK 44

  Fly    64 GDNHFCSGVLVSSRAVLTAAHCLTDRYKASMNPRGIRVVFG-HITRLAVYDESDFRSVDRLVVHP 127
            |....|.|.|:|.:.|||||||         ..|.|.|:.| |..|.....:...: |::.::|.
  Rat    45 GLRVICGGFLISRQFVLTAAHC---------KGREITVILGAHDVRKRESTQQKIK-VEKQIIHE 99

  Fly   128 EYERYKK-NDLAILRLSERVQ-SSNHDVLPLLMRKTANVTYGDTCITLGWGQIYQHGPYSNELVY 190
            .|..... :|:.:|:|.::|: :...:|:| |...:..:..|..|...|||:.....|.|..|..
  Rat   100 SYNSVPNLHDIMLLKLEKKVELTPAVNVVP-LPSPSDFIHPGAMCWAAGWGKTGVRDPTSYTLRE 163

  Fly   191 LDVILRPPSLCQKHYDTFTADHNVCT-EPVGESMNCAGDMGGPLLCKGALFGLIG-GHMGCAGGK 253
            :::.:.....| ..|..:.....||. .|........||.||||||.|...|::. ||.. |...
  Rat   164 VELRIMDEKAC-VDYRYYEYKFQVCVGSPTTLRAAFMGDSGGPLLCAGVAHGIVSYGHPD-AKPP 226

  Fly   254 AMKFLSFLYYKDWILLTIQSLS 275
            |: |.....|..||...|.:.|
  Rat   227 AI-FTRVSTYVPWINAVINTSS 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15873NP_611910.2 Tryp_SPc 36..250 CDD:214473 60/220 (27%)
Tryp_SPc 59..250 CDD:238113 54/195 (28%)
Mcpt2NP_742041.1 Tryp_SPc 20..239 CDD:214473 65/243 (27%)
Tryp_SPc 21..242 CDD:238113 66/240 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.