DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15873 and Klk1c2

DIOPT Version :9

Sequence 1:NP_611910.2 Gene:CG15873 / 37898 FlyBaseID:FBgn0035003 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_036809.1 Gene:Klk1c2 / 24841 RGDID:3888 Length:259 Species:Rattus norvegicus


Alignment Length:290 Identity:82/290 - (28%)
Similarity:116/290 - (40%) Gaps:70/290 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQILTVFLGLILSTSLSDADLGVIGDISDETFEMLISGGYKPKSNRLSRHVVSIRTKNYVRHRGD 65
            :|||:    |:||....||         ....:..|.||||.:.|.....|..|          :
  Rat     3 LQILS----LVLSVGRIDA---------APPGQSRIVGGYKCEKNSQPWQVAVI----------N 44

  Fly    66 NHFCSGVLVSSRAVLTAAHCLTDRYKASMNPRGIRVVFGHITRLAVYDESDF---RSVDRLVVHP 127
            .:.|.|||:....|:|||||.::.|         :|:.|   |..::.:..|   |.|.:...||
  Rat    45 EYLCGGVLIDPSWVITAAHCYSNNY---------QVLLG---RNNLFKDEPFAQRRLVRQSFRHP 97

  Fly   128 EY------------ERYKKNDLAILRLSERVQ-SSNHDVLPLLMRKTANVTYGDTCITLGWGQIY 179
            :|            .....|||.:|.|||... :....|:.|   .|.....|.||:..|||.. 
  Rat    98 DYIPLIVTNDTEQPVHDHSNDLMLLHLSEPADITGGVKVIDL---PTKEPKVGSTCLASGWGST- 158

  Fly   180 QHGP----YSNELVYLDVILRPPSLCQKHYDTFTADHNVCT-EPVGESMNCAGDMGGPLLCKGAL 239
              .|    .|::|..:::.|.....|.:.|.....|..:|. |..|....||||.||||:|.|.|
  Rat   159 --NPSEMVVSHDLQCVNIHLLSNEKCIETYKDNVTDVMLCAGEMEGGKDTCAGDSGGPLICDGVL 221

  Fly   240 FGLI-GGHMGCAG-------GKAMKFLSFL 261
            .|:. ||...||.       .|.:||.|::
  Rat   222 QGITSGGATPCAKPKTPAIYAKLIKFTSWI 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15873NP_611910.2 Tryp_SPc 36..250 CDD:214473 68/235 (29%)
Tryp_SPc 59..250 CDD:238113 60/212 (28%)
Klk1c2NP_036809.1 Tryp_SPc 24..251 CDD:214473 74/254 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.