DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15873 and CG30286

DIOPT Version :9

Sequence 1:NP_611910.2 Gene:CG15873 / 37898 FlyBaseID:FBgn0035003 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_726082.3 Gene:CG30286 / 246529 FlyBaseID:FBgn0050286 Length:277 Species:Drosophila melanogaster


Alignment Length:270 Identity:62/270 - (22%)
Similarity:103/270 - (38%) Gaps:57/270 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 GY-KPKSNRLSRHVVSIRTKNYVR--HRGDNHFCSGVLVSSRAVLTAAHCLTDRYKASMNPRGIR 100
            || .|::.:...|...|....::.  |:.....|.|.||:.|.:||||||:.:       ...:.
  Fly    27 GYMSPEALQNEEHQAHISESPWMAYLHKSGELVCGGTLVNHRFILTAAHCIRE-------DENLT 84

  Fly   101 VVFGHITRLAVYD---------ESDFRSVDRLVVHPEYERYKK-NDLAILRLSERVQSSNHDVLP 155
            |..|....|...|         ..|| .:|....|..|.|..: :|:.:|||::.|:...| :.|
  Fly    85 VRLGEFNSLTSIDCNGSDCLPPSEDF-EIDVAFRHGGYSRTNRIHDIGLLRLAKSVEYKVH-IKP 147

  Fly   156 LLMRKTANVTYG------DTCITLGWGQIYQHGPYSNELVYLDVILRPP-SLCQKHY------DT 207
            :.:  ..|.|..      ...:..|||:  .....:|.::....:.|.. .:|.|.|      |.
  Fly   148 ICL--ITNTTLQPKIERLHRLVATGWGR--SPSEAANHILKSIRVTRVNWGVCSKTYWVDRRRDQ 208

  Fly   208 FTADHNVCTEPVGESMNCAGDMGGPL-----LCKGALFGLIG----GHMGCAGGKAMKFLSFLYY 263
            ....|.       ..::|:||.|||:     |....||..:|    |:..|.....  |.:.:.:
  Fly   209 ICVSHE-------SGVSCSGDSGGPMGQAIRLDGRVLFVQVGIVSYGNAECLSPSV--FTNVMEH 264

  Fly   264 KDWILLTIQS 273
            .|||:..:.:
  Fly   265 IDWIMAALST 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15873NP_611910.2 Tryp_SPc 36..250 CDD:214473 57/245 (23%)
Tryp_SPc 59..250 CDD:238113 52/224 (23%)
CG30286NP_726082.3 Tryp_SPc 39..269 CDD:238113 58/251 (23%)
Tryp_SPc 39..268 CDD:214473 57/250 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436731
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.