DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15873 and CG30187

DIOPT Version :9

Sequence 1:NP_611910.2 Gene:CG15873 / 37898 FlyBaseID:FBgn0035003 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_001246475.2 Gene:CG30187 / 246509 FlyBaseID:FBgn0050187 Length:500 Species:Drosophila melanogaster


Alignment Length:285 Identity:80/285 - (28%)
Similarity:121/285 - (42%) Gaps:62/285 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 DLGV---IGDISDETFEMLISGGYKPK-SNRLSRHVVSIRTKNYVRHRGDNHF-CSGVLVSSRAV 79
            |:|.   :..|......:.|:||:... .|.:....|..||          || |.|.|:..|.|
  Fly    17 DVGASIFLDQICGINIALKITGGHNAAFQNSVWMAAVHNRT----------HFICGGTLIHKRFV 71

  Fly    80 LTAAHCLTDRYKASMNPRGIRVVFGHITRLAVY---DESDFRSVDRLVVHPEYE---RYKKNDLA 138
            ||||||:.|:...|::             |..|   |.:|.:.|...|||..::   .| :||:.
  Fly    72 LTAAHCIVDQDVQSVS-------------LGAYNKSDPADRKDVITAVVHSSFDVRASY-ENDIG 122

  Fly   139 ILRLSERVQSSNHDVLPL---LMRKTAN-VTYGDTCITLGWGQIYQHGPYSNELVYLDVILR--P 197
            :|:||..| ..|..:.|:   |.:..|| :....|....|||.:  .|..:::::. .:||.  .
  Fly   123 LLKLSSDV-IFNALIRPICIVLNKSMANHMRNMRTFKAFGWGTL--RGNKTSDILQ-TIILNHLD 183

  Fly   198 PSLCQKHYDTFTADHNVCT-EPVGESMNCAGDMGGPL----LCKG-----ALFGLIG-GHMGCAG 251
            ...|......:.::..:|. .|.|::  |.||.||||    ..:|     ..||:|. |...|.|
  Fly   184 REECYMELSVYPSEKQICAGVPSGDT--CGGDSGGPLTNDVFIQGIGNREVQFGIISVGKTSCDG 246

  Fly   252 -GKAMKFLSFLYYKDWILLTIQSLS 275
             |.....:||   .|||.:||:.||
  Fly   247 QGVYTDLMSF---ADWIKMTIERLS 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15873NP_611910.2 Tryp_SPc 36..250 CDD:214473 65/238 (27%)
Tryp_SPc 59..250 CDD:238113 58/214 (27%)
CG30187NP_001246475.2 Tryp_SPc 35..260 CDD:214473 71/257 (28%)
Trypsin 316..>384 CDD:355628
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.