DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15873 and CG30098

DIOPT Version :9

Sequence 1:NP_611910.2 Gene:CG15873 / 37898 FlyBaseID:FBgn0035003 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_725573.2 Gene:CG30098 / 246456 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster


Alignment Length:307 Identity:76/307 - (24%)
Similarity:113/307 - (36%) Gaps:97/307 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LILSTSLSDADLGVIG--DISDE----TFEMLISGGYKPKSNRLSRHVVSIRTKNYVRHRGDNHF 68
            ::|.|.|....||..|  .:.|.    .|.:.:.||...:......:::.           ||.|
  Fly     5 IVLLTFLVILTLGSYGYSQLLDSKCIALFRIRVIGGQNARRTPWMAYLIR-----------DNRF 58

  Fly    69 -CSGVLVSSRAVLTAAHC--LTDRYKASMNPRGIRVVFGHITRLAVYDESDFRSVD------RLV 124
             |.|.|::.|.|||||||  :.|..               ..||..||.|  |:.|      |:|
  Fly    59 ACGGSLIAYRFVLTAAHCTKINDNL---------------FVRLGEYDSS--RTTDGQTRSYRVV 106

  Fly   125 V---HPEYERYKKNDLAILRLSERVQSSNHDVLPLL------MRKTANVTYGDTCITLGWGQIYQ 180
            .   |..|..::.:|:|:|:|..:|....: :.|:.      ::..||.....|  ..||||:..
  Fly   107 SIYRHKNYIDFRNHDIAVLKLDRQVVYDAY-IRPICILLNSGLQSLANSIQNFT--LTGWGQMAH 168

  Fly   181 HGPYSNELVYLDVILR--------PPSL--CQKHYDTFTADHNVCTEPVGESMNCAGDMGGPLLC 235
            :  |.......::.||        .|||  |             |..||  ...|.||.||||  
  Fly   169 Y--YKMPTTLQEMSLRRVRNEYCGVPSLSIC-------------CWNPV--QYACFGDSGGPL-- 214

  Fly   236 KGAL-----------FGLIGGHMGCAGGKAMKFLSFLYYKDWILLTI 271
             |:|           ||:.....|...|.: .:|..:.|..|:..|:
  Fly   215 -GSLVKYGHKTIYVQFGVTNSVTGNCDGYS-SYLDLMSYMPWLYQTL 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15873NP_611910.2 Tryp_SPc 36..250 CDD:214473 63/252 (25%)
Tryp_SPc 59..250 CDD:238113 61/229 (27%)
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 66/269 (25%)
Tryp_SPc 37..258 CDD:238113 67/272 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436744
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.