DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15873 and CG30090

DIOPT Version :9

Sequence 1:NP_611910.2 Gene:CG15873 / 37898 FlyBaseID:FBgn0035003 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_725487.1 Gene:CG30090 / 246448 FlyBaseID:FBgn0050090 Length:291 Species:Drosophila melanogaster


Alignment Length:241 Identity:60/241 - (24%)
Similarity:98/241 - (40%) Gaps:50/241 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 HRGDNHFCSGVLVSSRAVLTAAHCLTDRYKASMNPRGIRVVFGHITRLAVYDE------------ 114
            |......|.|.|::.|.|||||||:.:       ...::|      ||..||:            
  Fly    58 HSSVKLICGGTLITQRFVLTAAHCVNE-------GSAVKV------RLGEYDDTATEDCNSKICI 109

  Fly   115 --SDFRSVDRLVVHPEYERYKK-NDLAILRLSERVQSSNHDVLPLLM----RKTANVTYGDTCIT 172
              ::...||....|.::...|. ||:|:|||::.|....| :.|:.:    .|...|...:..:.
  Fly   110 PRAEEHDVDMAFRHGKFSEIKNLNDIALLRLAKFVTFKAH-ISPICIILGTSKRELVDSIEWFVA 173

  Fly   173 LGWGQIYQHGPYSNELVYLDVILR-PPSLCQKHYDTFTADHNVCTEPVGESMNCAGDMGGPLL-- 234
            .|||:...|  .:..::.:..:.| ..|.|.:........:.:|...:| |..|.||.||||.  
  Fly   174 TGWGETRTH--RTRGVLQITQLQRYNSSQCMQALGRLVQQNQICAGRLG-SDTCNGDSGGPLFQT 235

  Fly   235 ------CKGALFGLIG-GHMGCAGGKAMKFLSFLY-YKDWILLTIQ 272
                  .:...||::. |...|:|   :...:.:| |.|||...:|
  Fly   236 VRHMDKMRPVQFGVVSYGSRECSG---IGVYTDVYSYADWIATVVQ 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15873NP_611910.2 Tryp_SPc 36..250 CDD:214473 52/216 (24%)
Tryp_SPc 59..250 CDD:238113 52/216 (24%)
CG30090NP_725487.1 Tryp_SPc 39..273 CDD:214473 57/234 (24%)
Tryp_SPc 40..276 CDD:238113 59/237 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436725
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.