DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15873 and CG30087

DIOPT Version :9

Sequence 1:NP_611910.2 Gene:CG15873 / 37898 FlyBaseID:FBgn0035003 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_725489.2 Gene:CG30087 / 246446 FlyBaseID:FBgn0050087 Length:277 Species:Drosophila melanogaster


Alignment Length:192 Identity:46/192 - (23%)
Similarity:84/192 - (43%) Gaps:31/192 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 YVRHRGDNHFCSGVLVSSRAVLTAAHCLTDRYKASMNPRGIRVVFGHITRLAVYD---------- 113
            ||.:....| |.|.:::||.:||||||:....:..:....||.           |          
  Fly    58 YVTNNSLTH-CGGSILNSRYILTAAHCVFPNLRLRLGEHNIRT-----------DPDCQGSNCSP 110

  Fly   114 ESDFRSVDRLVVHPEYERYKK-NDLAILRLSERVQSSNHDVLPL-LMRKTANVTYGDTCITLGWG 176
            .|:...:.:.:.|..|..... ||:|:|:|:..:..:.| :.|: ::...|:.....|..|.|||
  Fly   111 RSEEYGIMKAITHRFYNAANHVNDIALLKLNRSINFNVH-IQPICILLNPASAPSVATYQTFGWG 174

  Fly   177 QIYQHGPYSNELVYLDVILRPPSLCQKHYDTFTADHNVCTEPVG--ESMNCAGDMGGPLLCK 236
            :..::| :.:.|...::.....:.|.:.:..:...:.:|   .|  |...||||.||||:.:
  Fly   175 ETKKNG-FPHLLQTAELRAYDAAYCSRSFHAYMNGNQIC---AGHEERDTCAGDSGGPLVTR 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15873NP_611910.2 Tryp_SPc 36..250 CDD:214473 46/192 (24%)
Tryp_SPc 59..250 CDD:238113 46/192 (24%)
CG30087NP_725489.2 Tryp_SPc 41..270 CDD:214473 46/192 (24%)
Tryp_SPc 42..272 CDD:238113 46/192 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436733
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.