DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15873 and CG30083

DIOPT Version :9

Sequence 1:NP_611910.2 Gene:CG15873 / 37898 FlyBaseID:FBgn0035003 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster


Alignment Length:222 Identity:56/222 - (25%)
Similarity:95/222 - (42%) Gaps:41/222 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 CSGVLVSSRAVLTAAHCL-TDRYKASMNPRGIRVVFGHITRLAVYDESDFRSVDRLVVHPEYERY 132
            |.|.|:..:.||:||||: .|:..|              .||..:..|.:.:|.:...:..:...
  Fly    64 CGGTLIHKQFVLSAAHCIKRDQILA--------------VRLGEHSSSRYFAVTKAFRNKYFTTG 114

  Fly   133 K-KNDLAILRLSERVQSSNHDVLPLLM----RKTANVTYGDTCITLGWGQIYQHGPYSNELVYLD 192
            . .||:.|||: :.:...|..:.|:.:    .|..||   .|....|||:. ::..:|..|..::
  Fly   115 SYSNDIGILRI-QPIVKFNAVIRPICIITDPTKVPNV---KTFKAAGWGKT-ENETFSKVLKTVE 174

  Fly   193 VILRPPSLCQKHYDTFTADHNVCT-EPVGESMNCAGDMGGPLL----CKGAL----FGLI--GGH 246
            :.....|.|.........:..:|. .|.|::  ||||.||||:    ..|:|    .|:|  |..
  Fly   175 LNELNASECYNMLWVNVTESQICAGHPDGDT--CAGDSGGPLIHPVYMDGSLRYVQLGIISFGSS 237

  Fly   247 MGCAGGKAMKFLSFLYYKDWILLTIQS 273
            :..:.|...:..||:   ||||:.:.:
  Fly   238 LCNSPGVYTRLSSFI---DWILMVVDN 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15873NP_611910.2 Tryp_SPc 36..250 CDD:214473 49/197 (25%)
Tryp_SPc 59..250 CDD:238113 49/197 (25%)
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 53/214 (25%)
Tryp_SPc 34..255 CDD:238113 53/214 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436724
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.