DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15873 and PRSS55

DIOPT Version :9

Sequence 1:NP_611910.2 Gene:CG15873 / 37898 FlyBaseID:FBgn0035003 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_940866.2 Gene:PRSS55 / 203074 HGNCID:30824 Length:352 Species:Homo sapiens


Alignment Length:313 Identity:75/313 - (23%)
Similarity:122/313 - (38%) Gaps:64/313 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQILTVFLGLIL--------STSLSDADLGVIGDISDETFEMLISGGYKPK--------SNRLSR 49
            |.:.:|.|.|.|        .|.|.:|.:.::|         ...|.::|:        |....|
Human     1 MLLFSVLLLLSLVTGTQLGPRTPLPEAGVAILG---------RARGAHRPQPPHPPSPVSECGDR 56

  Fly    50 HVVSIRTKNYVRHRG------------------DNHFCSGVLVSSRAVLTAAHCLTDRYKASMNP 96
            .:...||: |.|..|                  ...||.|.:::...:|||||||   |...:.|
Human    57 SIFEGRTR-YSRITGGMEAEVGEFPWQVSIQARSEPFCGGSILNKWWILTAAHCL---YSEELFP 117

  Fly    97 RGIRVVFGHITRLAVYDESDFRSVDRLVVHPEYERYK-KNDLAILRLSERVQSSNHDVLPLLMRK 160
            ..:.||.|  |........:.:.|..:::|.:::|.. .||:|:|.|:..::..:..|...|..:
Human   118 EELSVVLG--TNDLTSPSMEIKEVASIILHKDFKRANMDNDIALLLLASPIKLDDLKVPICLPTQ 180

  Fly   161 TANVTYGDTCITLGWGQ--IYQHGPYSNELVYLDVILRPPSLCQKHYDTFTADHNVCTEPVGESM 223
            ....|:.: |...||||  .........:|:...:::.....|.|.:...| .:.:|.....||.
Human   181 PGPATWRE-CWVAGWGQTNAADKNSVKTDLMKAPMVIMDWEECSKMFPKLT-KNMLCAGYKNESY 243

  Fly   224 N-CAGDMGGPLLC------KGALFGLIGGHMGCAGGKAMK--FLSFLYYKDWI 267
            : |.||.||||:|      |....|:|.....| |.|...  :.|.:.|..||
Human   244 DACKGDSGGPLVCTPEPGEKWYQVGIISWGKSC-GEKNTPGIYTSLVNYNLWI 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15873NP_611910.2 Tryp_SPc 36..250 CDD:214473 59/249 (24%)
Tryp_SPc 59..250 CDD:238113 53/218 (24%)
PRSS55NP_940866.2 Tryp_SPc 67..295 CDD:214473 57/235 (24%)
Tryp_SPc 68..298 CDD:238113 58/236 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 308..330
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.