DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15873 and try-4

DIOPT Version :9

Sequence 1:NP_611910.2 Gene:CG15873 / 37898 FlyBaseID:FBgn0035003 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_508030.4 Gene:try-4 / 185148 WormBaseID:WBGene00006622 Length:324 Species:Caenorhabditis elegans


Alignment Length:304 Identity:65/304 - (21%)
Similarity:112/304 - (36%) Gaps:92/304 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 IGD-ISDETFEMLISGGYKPKSNRLSRHVVSIRTKNYVRH---------RGDNHFCSGVLVSSRA 78
            ||: .|.|:|:.::       .|.:......|:.::.:::         .|.|.. .|.::|...
 Worm    25 IGNAFSMESFQTIV-------DNEVLMESCGIQQESKIKNFPWAVSFTVDGVNRL-GGSIISPYH 81

  Fly    79 VLTAAH------------CLTDRYKASMNPRGIRVVFGHITRLAVYDESDFRS-VDRLVVHPEYE 130
            ::||||            |....:|...:.....:.|...||...|..:..|. .|:   :|...
 Worm    82 IITAAHGFITTIGSRGNLCENKNWKKPNSSIYRSIKFLRDTRKVAYGGTCIRGHTDK---YPNDP 143

  Fly   131 RYKKNDL-------------------------AILRLSERVQSSNHDVLPLLMRKTANVTYGDTC 170
            |.||:|:                         ||:.:.:|:..| .:|.|:.:.: .|:.|..:.
 Worm   144 RCKKSDVIHNKVRAVLVDGEFASSNCLKGHDWAIVEVEKRIHFS-ENVRPICLPR-PNMYYTKSL 206

  Fly   171 ITLGWGQIY---QHGPYSNELVYLDVILRPPSLCQKHY-DTFTADHN--VCTEPVGESMN----- 224
            ...|||:.|   :.||..:|     :.:|....|::.: |...||.:  :|    ..|||     
 Worm   207 AVPGWGRSYIFNESGPLIHE-----IPMRIDRDCKRPWSDRLPADADDFIC----ATSMNVSNYS 262

  Fly   225 ----CAGDMGGPLLCKGALFG---LIG----GHMGCAGGKAMKF 257
                |.||.||.|..:...:|   ||.    |..||......:|
 Worm   263 APRTCHGDSGGGLEYRDDNYGRAFLIAITSFGTRGCPSNMLARF 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15873NP_611910.2 Tryp_SPc 36..250 CDD:214473 58/282 (21%)
Tryp_SPc 59..250 CDD:238113 56/259 (22%)
try-4NP_508030.4 Tryp_SPc 51..318 CDD:238113 58/271 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.