DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15873 and CFD

DIOPT Version :9

Sequence 1:NP_611910.2 Gene:CG15873 / 37898 FlyBaseID:FBgn0035003 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_001304264.1 Gene:CFD / 1675 HGNCID:2771 Length:260 Species:Homo sapiens


Alignment Length:207 Identity:65/207 - (31%)
Similarity:92/207 - (44%) Gaps:13/207 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 HFCSGVLVSSRAVLTAAHCLTDRYKASMNPRGIRVVFGHITRLAVYDESDFRSVDRLVVHPEYER 131
            |.|.||||:.:.||:|||||.|.....     ::|:.|..:............|.|.|.||:.:.
Human    56 HLCGGVLVAEQWVLSAAHCLEDAADGK-----VQVLLGAHSLSQPEPSKRLYDVLRAVPHPDSQP 115

  Fly   132 YK-KNDLAILRLSERVQSSNHDVLPL-LMRKTANVTYGDTCITLGWGQIYQHG--PYSNELVYLD 192
            .. .:||.:|:|||:. :....|.|| ..|...:|..|..|...|||.:...|  |.|.:.|.|.
Human   116 DTIDHDLLLLQLSEKA-TLGPAVRPLPWQRVDRDVAPGTLCDVAGWGIVNHAGRRPDSLQHVLLP 179

  Fly   193 VILRPPSLCQKHYDTFTADHNVCTEPVGESMNCAGDMGGPLLCKGALFGLI-GGHMGCAGGKAMK 256
            |:.|.....:.|:|....:..:|.|. ....:|.||.||||:|.|.|.|:: .|...|...|...
Human   180 VLDRATCNRRTHHDGAITERLMCAES-NRRDSCKGDSGGPLVCGGVLEGVVTSGSRVCGNRKKPG 243

  Fly   257 -FLSFLYYKDWI 267
             :.....|..||
Human   244 IYTRVASYAAWI 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15873NP_611910.2 Tryp_SPc 36..250 CDD:214473 60/187 (32%)
Tryp_SPc 59..250 CDD:238113 60/187 (32%)
CFDNP_001304264.1 Tryp_SPc 32..255 CDD:214473 63/205 (31%)
Tryp_SPc 33..258 CDD:238113 65/207 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.