Sequence 1: | NP_611910.2 | Gene: | CG15873 / 37898 | FlyBaseID: | FBgn0035003 | Length: | 297 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001304264.1 | Gene: | CFD / 1675 | HGNCID: | 2771 | Length: | 260 | Species: | Homo sapiens |
Alignment Length: | 207 | Identity: | 65/207 - (31%) |
---|---|---|---|
Similarity: | 92/207 - (44%) | Gaps: | 13/207 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 67 HFCSGVLVSSRAVLTAAHCLTDRYKASMNPRGIRVVFGHITRLAVYDESDFRSVDRLVVHPEYER 131
Fly 132 YK-KNDLAILRLSERVQSSNHDVLPL-LMRKTANVTYGDTCITLGWGQIYQHG--PYSNELVYLD 192
Fly 193 VILRPPSLCQKHYDTFTADHNVCTEPVGESMNCAGDMGGPLLCKGALFGLI-GGHMGCAGGKAMK 256
Fly 257 -FLSFLYYKDWI 267 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG15873 | NP_611910.2 | Tryp_SPc | 36..250 | CDD:214473 | 60/187 (32%) |
Tryp_SPc | 59..250 | CDD:238113 | 60/187 (32%) | ||
CFD | NP_001304264.1 | Tryp_SPc | 32..255 | CDD:214473 | 63/205 (31%) |
Tryp_SPc | 33..258 | CDD:238113 | 65/207 (31%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |