DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15873 and CG43336

DIOPT Version :9

Sequence 1:NP_611910.2 Gene:CG15873 / 37898 FlyBaseID:FBgn0035003 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_001247122.1 Gene:CG43336 / 12798414 FlyBaseID:FBgn0263041 Length:279 Species:Drosophila melanogaster


Alignment Length:317 Identity:82/317 - (25%)
Similarity:120/317 - (37%) Gaps:104/317 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LTVF-LGLILSTSLSDADLGVIGDISDETFEMLISGGYKPKSNRLSRHVVSIRTKN---YVRHRG 64
            ||.| |.|:.||...|...|:              ..:.|...|:....|:..|.:   ...|..
  Fly     8 LTFFLLPLLGSTQFLDMACGI--------------RAHSPSVPRVKNGTVASLTSSPWMAFLHST 58

  Fly    65 DNHF-CSGVLVSSRAVLTAAHCLTDRYKASMNPRGIRVVFGHITRLAVYDESDFRSVDRLVVHPE 128
            |..| |.|.|:::|.|||||||..||.:.             :.||..||..::.     :.|..
  Fly    59 DGRFICGGSLITNRLVLTAAHCFLDRTEL-------------VARLGEYDREEYE-----MCHDS 105

  Fly   129 YERYK-------------------KNDLAILRLSERVQSSNHDVLPLLM------RKTANVTYGD 168
            |..|:                   ..|:|||||..:||.:: ::.|:.:      ||     |.|
  Fly   106 YCTYRIEAMVERGFRHRHYNPMTMAYDIAILRLYRKVQYTD-NIRPICIVIDPRWRK-----YID 164

  Fly   169 TCITL---GWGQIYQHGPYSNELVYLDVILRPPSLCQKHYDTFTADHNVCTEPVGESMNCAGDMG 230
            :...|   |||:....|. |.:|..:|:..:.|.:|:: |.|.:...|........|..|.||.|
  Fly   165 SLDPLTGTGWGKTESEGD-SAKLRTVDLARKHPEVCRR-YATLSLTANQFCAGNERSNLCNGDSG 227

  Fly   231 GPLLCKGALFGLIGGHMGCAGGKAMKFL-----SF--------------LYYKDWIL 268
            ||:   |||...         ||:.:|:     ||              :.|.||||
  Fly   228 GPV---GALIPY---------GKSKRFVQVGIASFTNTQCVMVSVFTDVMSYVDWIL 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15873NP_611910.2 Tryp_SPc 36..250 CDD:214473 63/245 (26%)
Tryp_SPc 59..250 CDD:238113 59/219 (27%)
CG43336NP_001247122.1 Tryp_SPc 37..271 CDD:214473 69/271 (25%)
Tryp_SPc 40..271 CDD:238113 68/268 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436729
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.