DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15873 and CG43335

DIOPT Version :9

Sequence 1:NP_611910.2 Gene:CG15873 / 37898 FlyBaseID:FBgn0035003 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_001247121.1 Gene:CG43335 / 12798413 FlyBaseID:FBgn0263040 Length:281 Species:Drosophila melanogaster


Alignment Length:235 Identity:61/235 - (25%)
Similarity:98/235 - (41%) Gaps:51/235 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 NHFCSGVLVSSRAVLTAAHCLTDRYKASMNPRGIRVVFGHITR----LAVYDESDFRSVDRLVVH 126
            ::||:|.|::::.|||||||:    :||.| ..:|:....:||    :......|: ||...:.|
  Fly    64 HYFCAGTLITNQFVLTAAHCI----EASKN-LTVRLGGSGLTRSDGSMCQITAEDY-SVSMAIKH 122

  Fly   127 PEY-ERYKKNDLAILRLSERVQSSNHDVLPLLMRKTANVTY----GDTCITLGWG--------QI 178
            ..: .....||:|::||:..|:..:| :.|:.:.....|..    |.|.:..|||        .:
  Fly   123 KYFTPSIMLNDIAMIRLARTVKFYDH-IRPICIILDPAVRLLLEDGMTLMATGWGLADKRMHPHL 186

  Fly   179 YQHGPYSNELVYLDVILRPPSLCQKHYDTFTADHNVCTEPVGESMNCAGDMGGPLLCKGALFGLI 243
            .|..|       :.|:.|  ::|.|.||.......:|... .|:..|.||.||||   |.:....
  Fly   187 LQEAP-------ITVMNR--NVCSKLYDVAITQGQICAGD-KETNTCLGDSGGPL---GGVVNYY 238

  Fly   244 G------------GHMGCAGGKAMKFLSFLYYKDWILLTI 271
            |            |.:.|........||  .|..||.:.:
  Fly   239 GDLRFVQYGITSFGDIECRSPSIYTDLS--TYSGWINMVV 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15873NP_611910.2 Tryp_SPc 36..250 CDD:214473 55/212 (26%)
Tryp_SPc 59..250 CDD:238113 55/212 (26%)
CG43335NP_001247121.1 Tryp_SPc 41..272 CDD:214473 59/229 (26%)
Tryp_SPc 42..275 CDD:238113 61/232 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436723
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.