DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42383 and UBXN11

DIOPT Version :9

Sequence 1:NP_523847.2 Gene:CG42383 / 37897 FlyBaseID:FBgn0259729 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_001376485.1 Gene:UBXN11 / 91544 HGNCID:30600 Length:520 Species:Homo sapiens


Alignment Length:430 Identity:93/430 - (21%)
Similarity:146/430 - (33%) Gaps:122/430 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 EQKLSTFMKRHGVREEVARQYLSSNN-----------WSLEVASSTYESEAVSKKQE-------- 49
            |:|:|......|:...|:||..:|::           |.||........|.:||.|:        
Human    47 EEKISVPSCYGGIGAPVSRQVPASHDSELMAFMTRKLWDLEQQVKAQTDEILSKDQKIAALEDLV 111

  Fly    50 ----PEKSSEHSQANE-----------SNRDLHSLLSEISRRKEGDHDGYQACASDSSTDH---D 96
                |..:....|..|           ..|::...||:...:..|:....:...|.:.::|   |
Human   112 QTLRPHPAEATLQRQEELETMCVQLQRQVREMERFLSDYGLQWVGEPMDQEDSESKTVSEHGERD 176

  Fly    97 TPAGKRVNINSSTPAITNNDSDRSLRVWGHGNRL---GSAHPINPPPRSATEDSDTEPADDEHTI 158
            ....|:......:.|....|.||.|......:.|   |... :.|.|..|...: .||       
Human   177 WMTAKKFWKPGDSLAPPEVDFDRLLASLQDLSELVVEGDTQ-VTPVPGGARLRT-LEP------- 232

  Fly   159 VVLHLWSEGFSLDDGSLRLYALPENERFLRAILRGDFPEEMLRV-PR-VQLSVQDHTNESYRHLS 221
            :.|.|:..|..:.||..:.:..|..:|.||.||.|.||.|:.|: |. |...|.|..|:.|....
Human   233 IPLKLYRNGIMMFDGPFQPFYDPSTQRCLRDILDGFFPSELQRLYPNGVPFKVSDLRNQVYLEDG 297

  Fly   222 RKQFMGPGR----------------------------------------------PLNS------ 234
            ...|.|.||                                              |:..      
Human   298 LDPFPGEGRVVGRQLMHKALDRVEEHPGSRMTAEKFLNRLPKFVIRQGEVIDIRGPIRDTLQNCC 362

  Fly   235 PSP---QILVVGPMPVEAQGLQLNERADT-----TTVQLRMADGSRVAGRFNL----THNVGDLY 287
            |.|   |.:||....:.|:..:..|..:|     :.::::..:|.:.   |.|    .:.:||: 
Human   363 PLPARIQEIVVETPTLAAERERSQESPNTPAPPLSMLRIKSENGEQA---FLLMMQPDNTIGDV- 423

  Fly   288 QYARLARPEFSDRS-FVLMTAFPRQELVESDTRTLVQANL 326
             .|.||:....|.| |.:.:.|| ..|.:.||.||..|.|
Human   424 -RALLAQARVMDASAFEIFSTFP-PTLYQDDTLTLQAAGL 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42383NP_523847.2 UBA_TAP-C_like 10..39 CDD:270459 8/39 (21%)
SEP 155..242 CDD:197786 30/143 (21%)
p47_UBX 257..336 CDD:176365 21/80 (26%)
UBXN11NP_001376485.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26
bchH <119..>256 CDD:237377 27/145 (19%)
SEP 235..306 CDD:400413 24/70 (34%)
UBX_UBXN11 395..464 CDD:340597 20/73 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 476..520
3 X 8 AA tandem repeats of P-G-P-G-P-G-P-S 487..510
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2086
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.