DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42383 and PUX4

DIOPT Version :9

Sequence 1:NP_523847.2 Gene:CG42383 / 37897 FlyBaseID:FBgn0259729 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_567262.1 Gene:PUX4 / 825736 AraportID:AT4G04210 Length:303 Species:Arabidopsis thaliana


Alignment Length:326 Identity:99/326 - (30%)
Similarity:151/326 - (46%) Gaps:64/326 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 SKKQEPEKSSEHSQANESNRDLHSLLSEISRRKEGDHDGYQACASDSSTDHDTP-----AGKRVN 104
            ||.::|.|.|       |:|.....||:::||.          ..||.:|.|.|     .|::..
plant     3 SKDKKPSKPS-------SSRGGIRTLSDLNRRS----------GPDSDSDSDGPQEYYTGGEKSG 50

  Fly   105 INSSTPAITNNDSDRSLRVWGHGNRLGSAH-PINPPPRSAT----------EDSDT---EPADDE 155
            :....|: ..:|.|   .::....:||:.. |:.|||.|.:          |:..|   :|....
plant    51 MLVQDPS-KKDDVD---EIFNQARQLGAVEGPLEPPPSSRSFTGTGRLLSGENVPTGNQQPEPVV 111

  Fly   156 HTIVVLHLWSEGFSLDDGSLRLYALPENERFLRAILRGDFPEEM----LRVP-RVQLSVQDHTNE 215
            |.||   .||.||::|||.||....|||..||.:|.:.:.|:|:    .|.| .|.|..::....
plant   112 HNIV---FWSNGFTIDDGPLRKLDDPENASFLESIRKSECPKELEPADRRAPVHVNLMRKEEKCP 173

  Fly   216 SYRHLSRKQFMGPGRPL-------NSPSPQILVVGPMPVE-----AQGLQLNERADTTTVQLRMA 268
            . |...|..|.|.||.|       .|.||......|:|::     :|.|.::|...||::|||:|
plant   174 E-RQKRRVSFQGVGRTLGGSNEGSGSSSPVAPDSAPIPIQTEPAPSQSLVIDETVPTTSIQLRLA 237

  Fly   269 DGSRVAGRFNLTHNVGDLYQYARLARPEFSDRSFVLMT-AFPRQELVESDTRTLVQANLCNVVVI 332
            ||:|:..:||..|.|.|:..:...:||..| .::.|.| .||.:.|.:. |:|:.:|.|.|.||:
plant   238 DGTRLVAKFNHHHTVNDIRGFIDSSRPGAS-LNYQLQTMGFPPKPLTDL-TQTIEEAGLANSVVL 300

  Fly   333 Q 333
            |
plant   301 Q 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42383NP_523847.2 UBA_TAP-C_like 10..39 CDD:270459
SEP 155..242 CDD:197786 34/98 (35%)
p47_UBX 257..336 CDD:176365 30/78 (38%)
PUX4NP_567262.1 SEP 108..189 CDD:197786 30/84 (36%)
UBX_UBXN2 231..302 CDD:340468 28/73 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2086
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54012
OrthoDB 1 1.010 - - D1175850at2759
OrthoFinder 1 1.000 - - FOG0001623
OrthoInspector 1 1.000 - - mtm1199
orthoMCL 1 0.900 - - OOG6_102041
Panther 1 1.100 - - O PTHR23333
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.880

Return to query results.
Submit another query.