DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42383 and AT3G21660

DIOPT Version :9

Sequence 1:NP_523847.2 Gene:CG42383 / 37897 FlyBaseID:FBgn0259729 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_001327364.1 Gene:AT3G21660 / 821720 AraportID:AT3G21660 Length:438 Species:Arabidopsis thaliana


Alignment Length:357 Identity:86/357 - (24%)
Similarity:151/357 - (42%) Gaps:67/357 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 MKRHGVREE--VARQYLSSNNWSLEVASSTYESE---------------------AVSKKQEPEK 52
            ::.:|..|.  :.|...||.:.|.|..||..|.|                     ::....:||.
plant   113 VEHYGGEENRAIERPEQSSRSMSEETVSSELEEEPQKVFTHTVTSWSNGFTVDDSSLKTLDDPEN 177

  Fly    53 SS--EHSQANESNRDLHSLLSEIS--RRKEGDHDGYQACASDSSTDHDTPAGKRVNINSSTPAIT 113
            ::  |...:.||.|:|..:..::.  .|:|.::...|| .|||::....||   :.:.:...||.
plant   178 ATFLEIISSMESPRELGQVRVQVKIISREEENYTESQA-GSDSASTKPPPA---LAMRAKESAIE 238

  Fly   114 NNDSDRSLRVWGHGNRLGSAHPINPPPRSATEDSDTEPADDEHTIV--VLHLWSEGFSLDDGSLR 176
            .  |::|.:|..     |..        .:.|..:.:..|..:.:|  .:.:|..||::||...:
plant   239 R--SEQSSKVLS-----GET--------DSAELQEQQQEDQPYEVVTYTVTIWRNGFTVDDDPFK 288

  Fly   177 LYALPENERFLRAILRGDFPE--EMLRVPRVQLSVQDHTNESYRHLSRKQFMGPGRPLNS---PS 236
            ....|||..||..|...:.|.  :.||| :|:|...:......:.|:..:......||.:   ||
plant   289 SLDDPENAAFLERITSLESPRLLDPLRV-QVKLIKCEENFSELQTLAGSESTSTEPPLTTTQPPS 352

  Fly   237 PQILVVGPMPVEAQGLQLNERADTTTVQLRMADGSRVAGRFNLTHNVGDLYQYARLARPEFSDRS 301
            ...|||.|            .|.||::||.:||.:|:..:||..|.:.|:..:...:||:.|...
plant   353 MSSLVVDP------------AAPTTSIQLILADSTRIVTQFNTHHTIRDIRCFIDTSRPDGSKDY 405

  Fly   302 FVLMTAFPRQELVESDTRTLVQANLCNVVVIQ 333
            .:|:...|...|.:.| :|:.:|.:.|.|::|
plant   406 QLLIMGSPPTPLSDFD-QTIEKAGIANSVLVQ 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42383NP_523847.2 UBA_TAP-C_like 10..39 CDD:270459 9/29 (31%)
SEP 155..242 CDD:197786 24/93 (26%)
p47_UBX 257..336 CDD:176365 24/77 (31%)
AT3G21660NP_001327364.1 SEP 148..222 CDD:413429 14/74 (19%)
SEP 273..>327 CDD:400413 17/54 (31%)
UBX_UBXN2 366..437 CDD:340468 21/72 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 42 1.000 Domainoid score I4801
eggNOG 1 0.900 - - E1_KOG2086
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1175850at2759
OrthoFinder 1 1.000 - - FOG0001623
OrthoInspector 1 1.000 - - mtm1199
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23333
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
87.970

Return to query results.
Submit another query.