DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42383 and Ubxn2a

DIOPT Version :9

Sequence 1:NP_523847.2 Gene:CG42383 / 37897 FlyBaseID:FBgn0259729 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_001102952.1 Gene:Ubxn2a / 685859 RGDID:1589027 Length:258 Species:Rattus norvegicus


Alignment Length:242 Identity:71/242 - (29%)
Similarity:111/242 - (45%) Gaps:46/242 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 PINPPPRSATE---DSDTEPAD------------DEHTIVVLHLWSEGFSLDDGSLRLYALPENE 184
            |:|..|:...|   ||..|.|:            .:...|.:.||..||:::| ..|.|:...::
  Rat    25 PLNDNPQKDCEYFVDSLFEEAEKAGAKCLSPTEQKKQVDVNIKLWKNGFTVND-DFRSYSDGASQ 88

  Fly   185 RFLRAILRGDFPEEMLRV---PRVQLSVQDHTNESYRHLSRK----QFMGPGRPLNSPSPQILVV 242
            :||.:|.:|:.|.|:..|   ..|.:.|:|..||..  :|.|    .|.|.|..|.|.:|:| |.
  Rat    89 QFLNSIKKGELPSELQGVFDKDEVDVKVEDKKNEVC--MSTKPVFQPFSGQGHRLGSATPRI-VS 150

  Fly   243 GPMPVEA------QGLQLNERADTTTVQLRMADGSRVAGRFNLTHNVGDL------YQYARLARP 295
            ....:|.      ..:.||.....|.:|:.:|:|.|...|||::|.|..:      ||..:.:.|
  Rat   151 KAKSIEVDNKSTLSAVSLNNLEPITRIQIWLANGERTVQRFNISHRVSHIKDFIEKYQGTQRSPP 215

  Fly   296 EFSDRSFVLMTAFPRQELVESDTRTLVQANLCNVVVIQHLNEEQVEP 342
                  |.|.||.|....:: :|.||.:|:|.|.|:||.| ::..||
  Rat   216 ------FALATALPFLRFLD-ETLTLEEADLQNAVIIQRL-QKTAEP 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42383NP_523847.2 UBA_TAP-C_like 10..39 CDD:270459
SEP 155..242 CDD:197786 29/93 (31%)
p47_UBX 257..336 CDD:176365 27/84 (32%)
Ubxn2aNP_001102952.1 SEP 66..139 CDD:400413 23/75 (31%)
UBX_UBXN2A 168..251 CDD:340680 30/90 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2086
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1175850at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
43.870

Return to query results.
Submit another query.