DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42383 and Ubxn2b

DIOPT Version :9

Sequence 1:NP_523847.2 Gene:CG42383 / 37897 FlyBaseID:FBgn0259729 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_080810.2 Gene:Ubxn2b / 68053 MGIID:1915303 Length:331 Species:Mus musculus


Alignment Length:331 Identity:107/331 - (32%)
Similarity:164/331 - (49%) Gaps:54/331 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 LEVA-SSTYESEAVSKKQEPEKSSEHSQANESNRDLHSLLSEISRRKEGDH--DGYQACASDSST 93
            |::| :..||.|...|..:|::|:. :.........|.|.|       |||  ||....      
Mouse    27 LQLALAELYEDEMKCKSSKPDRSTP-ATCRSPRTPPHRLYS-------GDHKYDGLHIV------ 77

  Fly    94 DHDTPAGKRVN-------------INSSTPAITNNDSDRSLRVWGHGNRLGSAHPINPPPRSATE 145
              ..|.||.||             :|.:|   .::..|::....|.|.|||::.    ..||...
Mouse    78 --QPPTGKIVNELFKEAREHGAVPLNEAT---RSSREDKTKSFTGGGYRLGNSF----YKRSEYI 133

  Fly   146 DSDTEPADDEHTIVVLHLWSEGFSLDDGSLRLYALPENERFLRAILRGDFPEEMLRV---PRVQL 207
            ..:.:..|.:   |:|.||..|||||||.||.|:.|.|.:||.::.||:.|.|:.|:   .:|.|
Mouse   134 YGENQLQDVQ---VLLKLWRNGFSLDDGELRPYSDPTNAQFLESVKRGETPLELQRLVHGAQVNL 195

  Fly   208 SVQDHTNESY--RHLSRKQFMGPGRPLNSPSPQILVVGPMPVEAQGLQLN------ERADTTTVQ 264
            .::||.::.|  ..|..|.|.|.|:.|.|.:|:|:.....|.|.....||      :...||.:|
Mouse   196 DMEDHQDQEYIKPRLRFKAFSGEGQKLGSLTPEIVSTPSSPEEEDKSILNAAVLIDDSMPTTKIQ 260

  Fly   265 LRMADGSRVAGRFNLTHNVGDLYQYARLARPEFSDRSFVLMTAFPRQELVESDTRTLVQANLCNV 329
            :|:|||||:..|||.||.:.|:..:...:||||:...|:|:|:||.:||.: :|.||.:|::.|.
Mouse   261 IRLADGSRLVQRFNSTHRILDVRDFIVRSRPEFATTDFILVTSFPSKELTD-ETVTLQEADILNT 324

  Fly   330 VVIQHL 335
            |::|.|
Mouse   325 VILQQL 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42383NP_523847.2 UBA_TAP-C_like 10..39 CDD:270459 2/7 (29%)
SEP 155..242 CDD:197786 37/91 (41%)
p47_UBX 257..336 CDD:176365 34/79 (43%)
Ubxn2bNP_080810.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..70 13/50 (26%)
SEP 140..232 CDD:197786 38/94 (40%)
p47_UBX 255..331 CDD:176365 34/77 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833361
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2086
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1175850at2759
OrthoFinder 1 1.000 - - FOG0001623
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR23333
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5790
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.930

Return to query results.
Submit another query.