DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42383 and ubxn2a

DIOPT Version :9

Sequence 1:NP_523847.2 Gene:CG42383 / 37897 FlyBaseID:FBgn0259729 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_001004828.1 Gene:ubxn2a / 448090 XenbaseID:XB-GENE-972873 Length:252 Species:Xenopus tropicalis


Alignment Length:245 Identity:71/245 - (28%)
Similarity:124/245 - (50%) Gaps:30/245 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 DRSLRVWGHGN---RLGSAHPINPPPRSATEDSDTEPA-------DDEHTIVVLHLWSEGFSLDD 172
            ||..|..|.|:   |..|.  :|    |..|:::...|       :|.:..|::.:|..||:::|
 Frog    14 DRGFRSGGRGSERKRCDSF--VN----SLFEEAENAGAFIASPEDEDSNADVIIKMWKNGFTIND 72

  Fly   173 GSLRLYALPENERFLRAILRGDFPEEMLRV---PRVQLSVQDHTNESYRHLSRK----QFMGPGR 230
            |.||.|:..||.:|:.::.:|:.|||:.:.   ..:.::|:|..||.|  |.||    .|.|.|.
 Frog    73 GYLRDYSGAENRQFMDSVRKGELPEELQKTFDKEEIAVNVEDRKNEEY--LLRKPNIDAFSGLGH 135

  Fly   231 PLNSPSPQILVVGPMPVEAQGL---QLNERADTTTVQLRMADGSRVAGRFNLTHNVGDLYQYARL 292
            .|.|.:|:::.........|.|   .|||....|.:::.:|||.|:..:||.:|.:.|:..:...
 Frog   136 RLGSAAPKVITKDMETCNEQSLPSVDLNELEPLTNIKVWLADGKRIVQKFNTSHRISDVRDFLER 200

  Fly   293 ARPEFSDRSFVLMTAFPRQELVESDTRTLVQANLCNVVVIQHLNEEQVEP 342
            ...:..:..|.|.|:||..:|:: ::.|:.:|.|.|.|::|.| :...||
 Frog   201 IPCKPGNAPFTLATSFPLHDLLD-ESLTIQEAELQNSVLVQKL-QRTTEP 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42383NP_523847.2 UBA_TAP-C_like 10..39 CDD:270459
SEP 155..242 CDD:197786 30/93 (32%)
p47_UBX 257..336 CDD:176365 21/78 (27%)
ubxn2aNP_001004828.1 SEP 61..135 CDD:311829 25/75 (33%)
p47_UBX 165..243 CDD:176365 22/79 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1175850at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.