DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42383 and Ubxn2a

DIOPT Version :9

Sequence 1:NP_523847.2 Gene:CG42383 / 37897 FlyBaseID:FBgn0259729 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_663416.1 Gene:Ubxn2a / 217379 MGIID:2442310 Length:258 Species:Mus musculus


Alignment Length:208 Identity:64/208 - (30%)
Similarity:105/208 - (50%) Gaps:24/208 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 PADDEHTI-VVLHLWSEGFSLDDGSLRLYALPENERFLRAILRGDFPEEMLRV---PRVQLSVQD 211
            |.:.:..: |.:.||..||:::| ..|.|:...:::||.:|.:|:.|.|:..:   ..|.:.|:|
Mouse    55 PTEQKKQVDVNIKLWKNGFTVND-DFRSYSDGASQQFLNSIKKGELPSELWGIFDKEEVDVKVED 118

  Fly   212 HTNESYRHLSRK----QFMGPGRPLNSPSPQILVVGPMPVEA------QGLQLNERADTTTVQLR 266
            ..||..  :|.|    .|.|.|..|.|.:|:| |.....||.      ..:.||.....|.:|:.
Mouse   119 KKNEVC--MSTKPVFQPFSGQGHRLGSATPRI-VSKAKSVEVDNKSTLSAVSLNNLEPITRIQIW 180

  Fly   267 MADGSRVAGRFNLTHNVGDLYQYARLARPEFSDRS--FVLMTAFPRQELVESDTRTLVQANLCNV 329
            :|:|.|...|||::|.|..:..:  :.:.:.|.||  |.|.||.|....:: :|.||.:|:|.|.
Mouse   181 LANGERTVQRFNVSHRVSHIKDF--IEKYQGSQRSPPFALATALPFLRFLD-ETLTLEEADLKNA 242

  Fly   330 VVIQHLNEEQVEP 342
            |:||.| ::..||
Mouse   243 VIIQRL-QKTAEP 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42383NP_523847.2 UBA_TAP-C_like 10..39 CDD:270459
SEP 155..242 CDD:197786 28/94 (30%)
p47_UBX 257..336 CDD:176365 27/80 (34%)
Ubxn2aNP_663416.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30
SEP 66..138 CDD:285322 22/74 (30%)
p47_UBX 171..249 CDD:176365 28/81 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2086
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1175850at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
43.870

Return to query results.
Submit another query.