DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42383 and Ubxn11

DIOPT Version :9

Sequence 1:NP_523847.2 Gene:CG42383 / 37897 FlyBaseID:FBgn0259729 Length:353 Species:Drosophila melanogaster
Sequence 2:XP_038965170.1 Gene:Ubxn11 / 192207 RGDID:620769 Length:533 Species:Rattus norvegicus


Alignment Length:424 Identity:83/424 - (19%)
Similarity:139/424 - (32%) Gaps:131/424 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTDEQKLSTFMKRHGVREEVARQYLSSNN---------WSLEVASSTYESEAVSKKQEPEKSSEH 56
            |..:.:|.|.|.|.  .:|:.:|..:.|.         .:||....|.:....|..:|.|..::.
  Rat   113 MIHDSELLTSMARK--LQELEQQLKARNEEMLSKEQKILALEDLVQTLQQHQSSTTREEELETQC 175

  Fly    57 SQANESNRDLHSLLSEISRRKEGDHDGYQACASDSSTDHDTPAGKRVNINSSTPAITNNDSDRSL 121
            .|......::...|::...:..|:           ..|.:...||.::.:.      ..|..::.
  Rat   176 IQLQRQVGEMERFLNDYGLQWVGE-----------PMDQENSEGKIISESD------ERDWMKAK 223

  Fly   122 RVWGHGNRL-----------------------GSAHPINPPPRSATEDSDTEPADDEHTIVVLHL 163
            :.|..|:.:                       |.|. :.|.|..| :....||       :.|.|
  Rat   224 KFWKPGDSIVPPEVDFDRLLSSLQDLSELVVEGEAQ-VTPVPGGA-QFRTLEP-------IPLKL 279

  Fly   164 WSEGFSLDDGSLRLYALPENERFLRAILRGDFPEEMLRV--PRVQLSVQDHTNESYRHLSRKQFM 226
            :..|..:.||..|.:..|..:|.||.||.|.||.|:.|:  ..|...|.|..|:.|.......|.
  Rat   280 YRNGIMMFDGPFRPFYDPYTQRCLRDILDGFFPSELQRLYPDGVPFKVSDLRNQVYPEDGLGPFP 344

  Fly   227 GPGRP--------------------------LNSPSPQILVVG-----------------PMPVE 248
            |.||.                          ||.....::..|                 ||||.
  Rat   345 GEGRVVGRQKIRKVTDRVEETSGSRMTAEKFLNRLPKCVIRQGEVIDIRGPIRDTLQNCCPMPVR 409

  Fly   249 AQGLQL------NERADT-----------TTVQLRMADGSRVAGRFNL----THNVGDLYQYARL 292
            .|.:.:      :||..|           :.::::..:|.:.   |.|    ...:||:......
  Rat   410 IQEIIVETPALASERQRTQESPNMPVPPLSMLRIKSENGEQA---FLLMMRPEDTIGDVRNLLAQ 471

  Fly   293 ARPEFSDRSFVLMTAFPRQELVESDTRTLVQANL 326
            || :....:|.:::.|| ..:...||.||..|.|
  Rat   472 AR-DMDSAAFEILSTFP-PTVYRDDTVTLQAAGL 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42383NP_523847.2 UBA_TAP-C_like 10..39 CDD:270459 7/37 (19%)
SEP 155..242 CDD:197786 28/114 (25%)
p47_UBX 257..336 CDD:176365 18/85 (21%)
Ubxn11XP_038965170.1 SEP 277..348 CDD:400413 24/70 (34%)
UBX_UBXN11 437..512 CDD:340597 16/72 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2086
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.