DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42383 and ubxn-2

DIOPT Version :9

Sequence 1:NP_523847.2 Gene:CG42383 / 37897 FlyBaseID:FBgn0259729 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_001023590.1 Gene:ubxn-2 / 177057 WormBaseID:WBGene00022381 Length:301 Species:Caenorhabditis elegans


Alignment Length:297 Identity:72/297 - (24%)
Similarity:115/297 - (38%) Gaps:51/297 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 EISRRKEG--DHDGYQACASDSSTDHDTPAGKRVNINSSTPAITNN-DSDRSLRVWGHGNRLGSA 133
            :|....:|  |.|...|.|::.....:..||....:.....|.... ||:..:|     ..|.:|
 Worm    10 DIGNNDDGGPDSDDSGADAAERGAPQEFYAGSGQAVQGPRGAAARGPDSEAHIR-----RILQAA 69

  Fly   134 HPINP----PPRSATEDSDTEPADDEHTIVVLHLWSEGFSLDDGSLRLYALPENERFLRAILRGD 194
            ..:.|    .||.       .|:..|...:.|||||:|.|::||.|.....|....||.::.:|:
 Worm    70 EVVQPEGGEAPRG-------RPSGRETISLTLHLWSDGLSIEDGPLMSRQDPRTIEFLESVGKGE 127

  Fly   195 FPEEMLRV---PRVQLSVQDHTNESYRHLSRKQFMGPGRPLNSPSPQILVVGPMPVEAQG----- 251
            .|..:::.   ..:...|..| :|.|.....|.|.|.|..|.:..|.:|..........|     
 Worm   128 IPPSLVQQYPGKEIDFKVNRH-HEEYVAPKMKPFGGSGVRLGNVVPTVLGQSSSSATTAGTSSAT 191

  Fly   252 ----------------------LQLNERADTTTVQLRMADGSRVAGRFNLTHNVGDLYQYARLAR 294
                                  |..|....||.:|:|:.:..|:.|.||.:|.:..:..:...||
 Worm   192 TDHNPDHTAENEAKQLEDAKKELSTNMNEPTTNIQIRLPNNQRLVGIFNHSHTLEAVRTFICTAR 256

  Fly   295 PEFSDRSFVLMTAFPRQELVESDTRTLVQANLCNVVV 331
            |:.....|.:|.|:|.:.. |.:::||..||:.|.||
 Worm   257 PDMIYAPFQMMAAYPPKPF-EDESQTLKDANVLNSVV 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42383NP_523847.2 UBA_TAP-C_like 10..39 CDD:270459
SEP 155..242 CDD:197786 27/89 (30%)
p47_UBX 257..336 CDD:176365 24/75 (32%)
ubxn-2NP_001023590.1 SEP 94..164 CDD:311829 22/70 (31%)
UBQ 220..292 CDD:320785 22/72 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 58 1.000 Domainoid score I7158
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 73 1.000 Inparanoid score I3880
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1175850at2759
OrthoFinder 1 1.000 - - FOG0001623
OrthoInspector 1 1.000 - - otm14349
orthoMCL 1 0.900 - - OOG6_102041
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.960

Return to query results.
Submit another query.