DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42383 and UBXN2A

DIOPT Version :9

Sequence 1:NP_523847.2 Gene:CG42383 / 37897 FlyBaseID:FBgn0259729 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_859064.2 Gene:UBXN2A / 165324 HGNCID:27265 Length:259 Species:Homo sapiens


Alignment Length:203 Identity:64/203 - (31%)
Similarity:106/203 - (52%) Gaps:23/203 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 PADDEHTI-VVLHLWSEGFSLDDGSLRLYALPENERFLRAILRGDFPEEMLRV---PRVQLSVQD 211
            ||:.:..: |.:.||..||:::| ..|.|:...:::||.:|.:|:.|.|:..:   ..|.:.|:|
Human    54 PAEQKKQVDVNIKLWKNGFTVND-DFRSYSDGASQQFLNSIKKGELPSELQGIFDKEEVDVKVED 117

  Fly   212 HTNESYRHLSRK----QFMGPGRPLNSPSPQILVVGPMPVEAQ------GLQLNERADTTTVQLR 266
            ..||..  ||.|    .|.|.|..|.|.:|:| |.....:|.:      .:.||.....|.:|:.
Human   118 KKNEIC--LSTKPVFQPFSGQGHRLGSATPKI-VSKAKNIEVENKNNLSAVPLNNLEPITNIQIW 179

  Fly   267 MADGSRVAGRFNLTHNVGDLYQYARLARPEFSDRS--FVLMTAFPRQELVESDTRTLVQANLCNV 329
            :|:|.|:..:||:||.|..:..:  :.:.:.|.||  |.|.||.|...|:: :|.||.:|:|.|.
Human   180 LANGKRIVQKFNITHRVSHIKDF--IEKYQGSQRSPPFSLATALPVLRLLD-ETLTLEEADLQNA 241

  Fly   330 VVIQHLNE 337
            |:||.|.:
Human   242 VIIQRLQK 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42383NP_523847.2 UBA_TAP-C_like 10..39 CDD:270459
SEP 155..242 CDD:197786 29/94 (31%)
p47_UBX 257..336 CDD:176365 28/80 (35%)
UBXN2ANP_859064.2 SEP 65..138 CDD:311829 23/75 (31%)
p47_UBX 170..248 CDD:176365 28/80 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2086
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1175850at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
32.870

Return to query results.
Submit another query.