Sequence 1: | NP_523847.2 | Gene: | CG42383 / 37897 | FlyBaseID: | FBgn0259729 | Length: | 353 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_859064.2 | Gene: | UBXN2A / 165324 | HGNCID: | 27265 | Length: | 259 | Species: | Homo sapiens |
Alignment Length: | 203 | Identity: | 64/203 - (31%) |
---|---|---|---|
Similarity: | 106/203 - (52%) | Gaps: | 23/203 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 151 PADDEHTI-VVLHLWSEGFSLDDGSLRLYALPENERFLRAILRGDFPEEMLRV---PRVQLSVQD 211
Fly 212 HTNESYRHLSRK----QFMGPGRPLNSPSPQILVVGPMPVEAQ------GLQLNERADTTTVQLR 266
Fly 267 MADGSRVAGRFNLTHNVGDLYQYARLARPEFSDRS--FVLMTAFPRQELVESDTRTLVQANLCNV 329
Fly 330 VVIQHLNE 337 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG42383 | NP_523847.2 | UBA_TAP-C_like | 10..39 | CDD:270459 | |
SEP | 155..242 | CDD:197786 | 29/94 (31%) | ||
p47_UBX | 257..336 | CDD:176365 | 28/80 (35%) | ||
UBXN2A | NP_859064.2 | SEP | 65..138 | CDD:311829 | 23/75 (31%) |
p47_UBX | 170..248 | CDD:176365 | 28/80 (35%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG2086 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1175850at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 1 | 0.960 | - | - | ||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.870 |