DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42383 and ubxn2b

DIOPT Version :9

Sequence 1:NP_523847.2 Gene:CG42383 / 37897 FlyBaseID:FBgn0259729 Length:353 Species:Drosophila melanogaster
Sequence 2:XP_004915243.2 Gene:ubxn2b / 101733824 XenbaseID:XB-GENE-13579709 Length:351 Species:Xenopus tropicalis


Alignment Length:244 Identity:85/244 - (34%)
Similarity:131/244 - (53%) Gaps:25/244 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 AITNNDSDRSLRVW-------GHGNRLGSAHPINPPPRSATEDSDTEPADDEHTI-VVLHLWSEG 167
            ||..:|:.:|...:       |.|.:||     |...|........||.:....| ::|.|||.|
 Frog   113 AIPIDDASKSSGAFYKARTFTGRGYKLG-----NSSKRELEYIQGEEPFEQGQEIQILLKLWSNG 172

  Fly   168 FSLDDGSLRLYALPENERFLRAILRGDFPEEMLRV---PRVQLSVQDHTNESY--RHLSRKQFMG 227
            ||||||.||.|:.|.|..||.::.:|:.|.|:.|:   .:|.|.::||.::.|  ..|..|.|.|
 Frog   173 FSLDDGELRSYSDPINAEFLESVKKGEIPVELQRLIHGGQVNLDMEDHQDQEYVKPRLKFKAFSG 237

  Fly   228 PGRPLNSPSPQILVVGPMPVEAQ------GLQLNERADTTTVQLRMADGSRVAGRFNLTHNVGDL 286
            .|:.|.|.:|:|:.....|.|..      .:.|:|...||.:|:|:|||:|:..||||:|.:.|:
 Frog   238 EGKKLGSLTPEIISTPSSPEEEHKRFLNAEVDLDEHVPTTKIQIRLADGTRLIQRFNLSHRIMDV 302

  Fly   287 YQYARLARPEFSDRSFVLMTAFPRQELVESDTRTLVQANLCNVVVIQHL 335
            ..|...||.:|:...|.|:|.||..||.: :::||.:|::.|.|::|.|
 Frog   303 RHYIIHARSDFAQCDFALVTTFPFVELTD-ESQTLEEADILNTVILQRL 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42383NP_523847.2 UBA_TAP-C_like 10..39 CDD:270459
SEP 155..242 CDD:197786 37/92 (40%)
p47_UBX 257..336 CDD:176365 32/79 (41%)
ubxn2bXP_004915243.2 SEP 160..252 CDD:197786 37/91 (41%)
Ubiquitin_like_fold 270..351 CDD:421700 34/82 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1175850at2759
OrthoFinder 1 1.000 - - FOG0001623
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR23333
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.