DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SerT and SLC6A7

DIOPT Version :9

Sequence 1:NP_001369117.1 Gene:SerT / 37895 FlyBaseID:FBgn0010414 Length:768 Species:Drosophila melanogaster
Sequence 2:XP_016865256.1 Gene:SLC6A7 / 6534 HGNCID:11054 Length:754 Species:Homo sapiens


Alignment Length:583 Identity:244/583 - (41%)
Similarity:342/583 - (58%) Gaps:47/583 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 RETWGQKAEFLLAVIGFAVDLGNVWRFPYICYQNGGGAFLVPYCLFLIFGGLPLFYMELALGQFH 138
            |..|..|.:|||:.||:.|.|||||||||..|.||||||||||.|.|...|:|||::||:||||.
Human   118 RGNWTGKLDFLLSCIGYCVGLGNVWRFPYRAYTNGGGAFLVPYFLMLAICGIPLFFLELSLGQFS 182

  Fly   139 RCGCLSIWKRICPALKGVGYAICLIDIYMGMYYNTIIGWAVYYLFASFTSKLPWTSCDNPWNTEN 203
            ..|.|::|| |.|..||.|.|:.||...:.:|||.||.:.::|||||.||.|||..|.|.||||.
Human   183 SLGPLAVWK-ISPLFKGAGAAMLLIVGLVAIYYNMIIAYVLFYLFASLTSDLPWEHCGNWWNTEL 246

  Fly   204 CMQ-----------------------------------------VTSENFTELATSP----AKEF 223
            |::                                         |.|.::.::...|    |:|.
Human   247 CLEHRVSKDGNGALPLNLTCTVSPSEEYWSQTHTEAEEEGRRGRVVSNSYPQVIFLPQPPKAEEG 311

  Fly   224 FERKVLESYKGNGLDFMGPVKPTLALCVFGVFVLVYFSLWKGVRSAGKVVWVTALAPYVVLIILL 288
            ..|.||......|:...|.::..|.||:...:|:|:..:.|||:|:||||:.||..||::|::||
Human   312 VSRYVLHIQGSQGIGSPGEIRWNLCLCLLLAWVIVFLCILKGVKSSGKVVYFTATFPYLILLMLL 376

  Fly   289 VRGVSLPGADEGIKYYLTPEWHKLKNSKVWIDAASQIFFSLGPGFGTLLALSSYNKFNNNCYRDA 353
            ||||:||||.:||::||||::|.|.:|||||:||.|||:|||.|||.||..:|||.|:.|.|||.
Human   377 VRGVTLPGAWKGIQFYLTPQFHHLLSSKVWIEAALQIFYSLGVGFGGLLTFASYNTFHQNIYRDT 441

  Fly   354 LITSSINCLTSFLAGFVIFSVLGYMAYVQKTSIDKVGLEGPGLVFIVYPEAIATMSGSVFWSIIF 418
            .|.:..|.:||.||||.||||||||:......:|:|...||||.|:|||:|:..:..|.|||.:|
Human   442 FIVTLGNAITSILAGFAIFSVLGYMSQELGVPVDQVAKAGPGLAFVVYPQAMTMLPLSPFWSFLF 506

  Fly   419 FLMLITLGLDSTFGGLEAMITALCDEYPRVIGRRRELFVLLLLAFIFLCALPTMTYGGVVLVNFL 483
            |.||:||||||.|..||.::||:.||:|..:..::.:|..|:...::|..|...|.||:..:..|
Human   507 FFMLLTLGLDSQFAFLETIVTAVTDEFPYYLRPKKAVFSGLICVAMYLMGLILTTDGGMYWLVLL 571

  Fly   484 NVYGPGLAILFVVFVEAAGVFWFYGVDRFSSDVEQMLGSKPGLFWRICWTYISPVFLLTIFIFSI 548
            :.|.....::.||......|...||:.||..|:..|||.||||::|.||.::||..||.:.::||
Human   572 DDYSASFGLMVVVITTCLAVTRVYGIQRFCRDIHMMLGFKPGLYFRACWLFLSPATLLALMVYSI 636

  Fly   549 MGYKEMLGEEYYYPDWSYQVGWAVTCSSVLCIPMYIIYKFFFASKGGCRQRLQESFQPEDNCG 611
            :.|:......|.:|.|:..:|..:...|.|.||..::.. ....:|...:|||::.:|..:.|
Human   637 VKYQPSEYGSYRFPPWAELLGILMGLLSCLMIPAGMLVA-VLREEGSLWERLQQASRPAMDWG 698

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SerTNP_001369117.1 SLC6sbd_SERT-like 74..607 CDD:271388 242/577 (42%)
SLC6A7XP_016865256.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0733
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D250396at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.