DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RBMY1B and NSR1

DIOPT Version :9

Sequence 1:NP_001006121.1 Gene:RBMY1B / 378948 HGNCID:23914 Length:496 Species:Homo sapiens
Sequence 2:NP_011675.1 Gene:NSR1 / 853064 SGDID:S000003391 Length:414 Species:Saccharomyces cerevisiae


Alignment Length:297 Identity:65/297 - (21%)
Similarity:108/297 - (36%) Gaps:61/297 - (20%)


- Green bases have known domain annotations that are detailed below.


Human     3 EADHPGKLFIGGLNRETNEKMLKAVFGKHGPISEVLLIKDR-TSKSRGFAFITFENPADAKNAAK 66
            |.:.|..:|:|.|:...:::.||..|...|.:....:|.:| |.:|||:.::.|||.:.|:.|.:
Yeast   163 ETEEPATIFVGRLSWSIDDEWLKKEFEHIGGVIGARVIYERGTDRSRGYGYVDFENKSYAEKAIQ 227

Human    67 DMNGKSLHGKAIKVEQAKKPSFQSGGRRRPPASSRNRSPSGSLRSARGSRGGTRGWLPSQEGHLD 131
            :|.||.:.|:.|..:.:                  ...|:|:  :.|..:.|.....||....|.
Yeast   228 EMQGKEIDGRPINCDMS------------------TSKPAGN--NDRAKKFGDTPSEPSDTLFLG 272

Human   132 DGGYTPD----LKMSYSRGLIPVKRGPSSRSGGPPPKKSAPSA---VARSNSWMGSQGPMSQRRE 189
            :..:..|    .::....|.:...|.|:.      |:...|..   |..||.....:...:.:.|
Yeast   273 NLSFNADRDAIFELFAKHGEVVSVRIPTH------PETEQPKGFGYVQFSNMEDAKKALDALQGE 331

Human   190 NYGVPPRRATISSWRNDRMSTRHDGYATNDGNHPSCQETRDYAPPSRGYAYRDNGHSNRDEHSSR 254
            .....|.|...||.|           ..|||....          |||:..|..|..     .:|
Yeast   332 YIDNRPVRLDFSSPR-----------PNNDGGRGG----------SRGFGGRGGGRG-----GNR 370

Human   255 GYRNHRSSRETR-DYAPPSRGHAYRDYGHSRRDESYS 290
            |:.....:|..| .:.|...|......|.||...|::
Yeast   371 GFGGRGGARGGRGGFRPSGSGANTAPLGRSRNTASFA 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RBMY1BNP_001006121.1 RRM <1..189 CDD:223796 41/193 (21%)
RRM_RBMX_like 7..85 CDD:240828 24/78 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 67..349 45/232 (19%)
RBM1CTR 174..218 CDD:285341 8/43 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 452..496
NSR1NP_011675.1 RRM1_gar2 169..244 CDD:409881 23/74 (31%)
RRM2_gar2 269..341 CDD:409882 13/77 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 66 1.000 Domainoid score I2660
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.