DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpn8 and MPND

DIOPT Version :9

Sequence 1:NP_001261167.1 Gene:Rpn8 / 37894 FlyBaseID:FBgn0002787 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_001287791.1 Gene:MPND / 84954 HGNCID:25934 Length:501 Species:Homo sapiens


Alignment Length:207 Identity:40/207 - (19%)
Similarity:70/207 - (33%) Gaps:76/207 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SVNK-------VIVHPLVLLSVVDHFNRMGKIGNQKRVVGVLLGCWR-SKGVLDVSNSFAVPFDE 63
            ::||       |..:.|.||....|..|       ..|||.|.|.|. :..:|.|..:|......
Human   263 AINKFQPFNVAVSSNVLFLLDFHSHLTR-------SEVVGYLGGRWDVNSQMLTVLRAFPCRSRL 320

  Fly    64 DDKDKSVWFLDHDYLENMY--GMFKKVNARERVVGWYHTG------PKLHQNDIAINELVR---- 116
            .|.:.:. .::.:..::::  |:        .:|||||:.      |.|...|..::..:|    
Human   321 GDAETAA-AIEEEIYQSLFLRGL--------SLVGWYHSHPHSPALPSLQDIDAQMDYQLRLQGS 376

  Fly   117 ------------------------RYCPNSVLVIIDAKPKDLGLPTE---AYISVEEVHDD---- 150
                                    :..|..|:...:.:|.|.|:|.:   ||:....:.:|    
Human   377 SNGFQPCLALLCSPYYSGNPGPESKISPFWVMPPPEQRPSDYGIPMDVEMAYVQDSFLTNDILHE 441

  Fly   151 ---------GSP 153
                     |||
Human   442 MMLLVEFYKGSP 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpn8NP_001261167.1 PLN03246 7..308 CDD:215645 40/207 (19%)
MPN_RPN7_8 9..290 CDD:163693 40/205 (20%)
MPNDNP_001287791.1 MPN_2A_DUB 266..450 CDD:163698 36/199 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1310
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.