DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpn8 and EIF2

DIOPT Version :9

Sequence 1:NP_001261167.1 Gene:Rpn8 / 37894 FlyBaseID:FBgn0002787 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_181528.1 Gene:EIF2 / 818587 AraportID:AT2G39990 Length:293 Species:Arabidopsis thaliana


Alignment Length:278 Identity:78/278 - (28%)
Similarity:136/278 - (48%) Gaps:10/278 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SQEVSVNKVIVHPLVLLSVVDHFNRMGKIGNQKRVVGVLLGCWRSKGVLDVSNSFAVPFDEDDKD 67
            |...||....:||||:.:|.|.|.|  :..:.:||:|.|||.....|.:|:.||:|||.:|....
plant    20 SATTSVLTARIHPLVIFNVCDCFVR--RPDSAERVIGTLLGSILPDGTVDIRNSYAVPHNESSDQ 82

  Fly    68 KSVWFLDHDYLENMYGMFKKVNARERVVGWYHTGPKLHQNDIAINELVRRYCPNSVLVIIDAKPK 132
            .:|   |.||..||.....|||::|.:||||.||..::.....|::...|..||.:.:.:|....
plant    83 VAV---DIDYHHNMLASHLKVNSKETIVGWYSTGAGVNGGSSLIHDFYAREVPNPIHLTVDTGFT 144

  Fly   133 DLGLPTEAYISVEEVHDDGSPTSKTFEHVPSEIGAEEAEEVGVEHLLRDIKDTTVGSLSQKITNQ 197
            :.....:|::|......|....:. |:.:|.::...:||.||.:.|    |.|:|..|...:...
plant   145 NGEGTIKAFVSSNLSLGDRQLVAH-FQEIPVDLRMVDAERVGFDVL----KATSVDKLPNDLEGM 204

  Fly   198 LMGLKGLNAQLRDIKQYLQRVGDSKMPINHQIVYQLQDIFNLLPDITNDQFTGTMYVKTNDQMLV 262
            .:.::.|...:.|:.:|:..|...::..::.|...:.|....||.:....|...:.....||:|:
plant   205 ELTMERLLTLINDVYKYVDSVVGGQIAPDNNIGRFIADAVASLPKLPPQVFDNLVNDSLQDQLLL 269

  Fly   263 VYLASMVRSIIALHNLIN 280
            :||:|:.|:.::|...:|
plant   270 LYLSSITRTQLSLAEKLN 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpn8NP_001261167.1 PLN03246 7..308 CDD:215645 77/274 (28%)
MPN_RPN7_8 9..290 CDD:163693 75/272 (28%)
EIF2NP_181528.1 MPN_eIF3f 29..286 CDD:163695 74/266 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1310
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.