DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpn8 and Mpnd

DIOPT Version :10

Sequence 1:NP_001261167.1 Gene:Rpn8 / 37894 FlyBaseID:FBgn0002787 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_080806.4 Gene:Mpnd / 68047 MGIID:1915297 Length:487 Species:Mus musculus


Alignment Length:246 Identity:48/246 - (19%)
Similarity:81/246 - (32%) Gaps:85/246 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SVNK-------VIVHPLVLLSVVDHFNRMGKIGNQKRVVGVLLGCWR-SKGVLDVSNSFAVPFDE 63
            ::||       |..:.|.||....|..|       ..|||.|.|.|. :..:|.|..:|......
Mouse   249 AINKFQPFNVAVSSNVLFLLDFHCHLTR-------SEVVGYLGGRWDINNQMLTVLRAFPCRSRL 306

  Fly    64 DDKDKSVWFLDHDY-LENMYGMFKKVNARERVVGWYHTG------PKLHQNDIAINELVR----- 116
            .|.|.:....:..| :..:.|:        .:|||||:.      |.|...|..:...:|     
Mouse   307 GDTDTAATVEEEIYQVLFLRGL--------SLVGWYHSHPHSPAVPSLQDIDAQMEYQLRLQGSS 363

  Fly   117 -----------------------RYCPNSVLVIIDAKPKDLGLPTE---AYISVEEVHDD----- 150
                                   :.||..|:...:.:|.|.|:|.:   ||:....:.:|     
Mouse   364 NGFQPCLALLCSPYYSGNPGPESKICPFWVMPPPEQRPSDYGIPMDVEMAYVQDSFLTNDVLQEM 428

  Fly   151 --------GSPTSKTF------EH-----VPSEIGAEEAEEVGVEHLLRDI 182
                    |:|....|      ||     :...:.:...::.|:.|:|..:
Mouse   429 VMLAEFYKGAPDLVKFQEAWSPEHTYLDKLKMSLASRTPKDQGMCHVLEQV 479

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpn8NP_001261167.1 MPN_RPN7_8 9..290 CDD:163693 48/244 (20%)
MpndNP_080806.4 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..55
RAMA 57..157 CDD:465856
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 163..217
MPN_2A_DUB 252..436 CDD:163698 39/198 (20%)
JAMM motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01182 335..348 3/12 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.