DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpn8 and Mpnd

DIOPT Version :9

Sequence 1:NP_001261167.1 Gene:Rpn8 / 37894 FlyBaseID:FBgn0002787 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_080806.4 Gene:Mpnd / 68047 MGIID:1915297 Length:487 Species:Mus musculus


Alignment Length:246 Identity:48/246 - (19%)
Similarity:81/246 - (32%) Gaps:85/246 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SVNK-------VIVHPLVLLSVVDHFNRMGKIGNQKRVVGVLLGCWR-SKGVLDVSNSFAVPFDE 63
            ::||       |..:.|.||....|..|       ..|||.|.|.|. :..:|.|..:|......
Mouse   249 AINKFQPFNVAVSSNVLFLLDFHCHLTR-------SEVVGYLGGRWDINNQMLTVLRAFPCRSRL 306

  Fly    64 DDKDKSVWFLDHDY-LENMYGMFKKVNARERVVGWYHTG------PKLHQNDIAINELVR----- 116
            .|.|.:....:..| :..:.|:        .:|||||:.      |.|...|..:...:|     
Mouse   307 GDTDTAATVEEEIYQVLFLRGL--------SLVGWYHSHPHSPAVPSLQDIDAQMEYQLRLQGSS 363

  Fly   117 -----------------------RYCPNSVLVIIDAKPKDLGLPTE---AYISVEEVHDD----- 150
                                   :.||..|:...:.:|.|.|:|.:   ||:....:.:|     
Mouse   364 NGFQPCLALLCSPYYSGNPGPESKICPFWVMPPPEQRPSDYGIPMDVEMAYVQDSFLTNDVLQEM 428

  Fly   151 --------GSPTSKTF------EH-----VPSEIGAEEAEEVGVEHLLRDI 182
                    |:|....|      ||     :...:.:...::.|:.|:|..:
Mouse   429 VMLAEFYKGAPDLVKFQEAWSPEHTYLDKLKMSLASRTPKDQGMCHVLEQV 479

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpn8NP_001261167.1 PLN03246 7..308 CDD:215645 48/246 (20%)
MPN_RPN7_8 9..290 CDD:163693 48/244 (20%)
MpndNP_080806.4 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..55
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 163..217
MPN_2A_DUB 252..436 CDD:163698 39/198 (20%)
JAMM motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01182 335..348 3/12 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1310
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.